Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP004941HU |
| Product Type | Recombinant Protein |
| Size | US$2474 |
| Uniprot No. | P09326 |
| Relevance | Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation. |
| Image |
|
| Storage Buffer | Tris-based buffer，50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS |
| Research Area | Immunology |
| Source | Yeast |
| Gene Names | CD48 |
| Protein Names | B-lymphocyte activation marker BLAST-1 BCM1 surface antigen Leukocyte antigen MEM-102 SLAM family member 2 Short name: SLAMF2 Signaling lymphocytic activation molecule 2 TCT.1 CD_antigen: CD48 BCM1, BLAST1 |
| Expression Region | 27-220aa |
| Tag Info | N-terminal FC-tagged |
| Mol. Weight | 48.3 kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Ligand for CD2. Might facilitate interaction between activated lymphocytes. Probably involved in regulating T-cell activation. |
| Subcellular Location | Cell membrane, Lipid-anchor, GPI-anchor |
| Database Links |
HGNC: 1683 OMIM: 109530 KEGG: hsa:962 STRING: 9606.ENSP00000357025 UniGene: Hs.243564 |
| Pathway | Natural killer cell mediated cytotoxicity |
CD48 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA004941GA01HU | CD48 Antibody | Human | ELISA |
| CSB-PA005223 | CD48 Antibody | Human | WB,ELISA |
| CSB-PA074453 | CD48 Antibody | Human,Mouse | ELISA,WB,IHC |
| CSB-PA183273 | CD48 Antibody | Human,Mouse | ELISA,WB,IHC |
CD48 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA004941ESR1HU | CD48 Antibody | Human | ELISA, IHC |
| CSB-PA004941ESR2HU | CD48 Antibody | Human, Mouse | ELISA, WB |
CD48 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP004941HU CSB-BP004941HU CSB-MP004941HU |
Recombinant Human CD48 antigen(CD48) | E.coli Baculovirus Mammalian cell |
CD48 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL004941HU | Human CD48 antigen(CD48) ELISA kit | serum, plasma, urine, tissue homogenates | 1.56 ng/mL |
Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human ATP synthase subunit delta, mitochondrial(ATP5D)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Cysteine-rich protein 1(CRIP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Myc proto-oncogene protein(MYC),Escherichia Coli
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
