Recombinant Human Calbindin (CALB1)

In Stock
Code CSB-YP004432HU
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CALB1
Uniprot No.
Research Area
Others
Alternative Names
(Calbindin D28)(D-28K)(Vitamin D-dependent calcium-binding protein, avian-type)
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
2-261aa
Target Protein Sequence
AESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
30.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human CALB1 protein is produced by manipulating the expression of specific genes in Yeast cells. A DNA sequence encoding the Human CALB1 protein (2-261aa) is fused to an expression vector and subsequently transformed into Yeast cells. The cells that successfully integrate the vector are selected and cultured to induce the expression of the desired protein. A C-terminal 6xHis tag is attached to the protein. The recombinant Human CALB1 protein protein is then purified using affinity purification, achieving a purity level of over 85%, as confirmed by SDS-PAGE analysis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Buffers cytosolic calcium. May stimulate a membrane Ca(2+)-ATPase and a 3',5'-cyclic nucleotide phosphodiesterase.
Gene References into Functions
  1. CSF calbindin concentration is a sensitive biomarker of NPC1 disease PMID: 27307499
  2. We identified a significant association between the A allele of rs1805874 and the risk of Parkinson's disease (OR 1.257, 95% CI 1.036-1.524, p = 0.020). Our findings suggest that the A allele of rs1805874 is associated with risk of Parkinson's disease among the Han Chinese. Our results, combined with previous studies, suggest that rs1805874 is associated with Parkinson's disease in East Asians, but not Caucasians. PMID: 27611799
  3. Age-related loss of CB appears to coincide with tangle formation in the BFCN and is associated with the full range of tau pathology, including late appearing epitopes. PMID: 26417681
  4. Increased number of calbindin neurons and fiber labeling both in focal cortical dysplasia (FCD) and non-FCD specimens compared with postmortem controls may be associated with ongoing seizure activity. PMID: 26081613
  5. expressed by different neuron types, both inhibitory (GABAergic) and excitatory (glutamatergic), involved in both intrinsic and extrinsic circuits of the human cerebellar cortex PMID: 24719368
  6. The calbindin-D 28k was decreased in the putamen, the dorsal tier of the substantia nigra along the lower border of the red nucleus, and in the cerebellar cortex in multiple system atrophy. PMID: 23715974
  7. Significantly reduced hippocampal calbindin D28K levels are found in all patients with mitochondrial encephalomyopathy, lactic acidosis and stroke-like syndrome (MELAS). PMID: 22483853
  8. Data show calbindin (CB)- and tyrosine hydroxylase (TH)-cells were distributed in the three striatal territories, and the density of calretinin (CR) and parvalbumin (PV) interneurons were more abundant in the associative and sensorimotor striatum. PMID: 22272358
  9. Dynamics of Ca2+ ions within the solvation shell of calbindin D9k. PMID: 21364983
  10. upregulated in endometriosis tissues PMID: 20452033
  11. cultured syncytiotrophoblast cells express calbindin-D9k and calbindin-D28k genes, which are stimulated by calcitriol PMID: 20214988
  12. Our study shows there is no association between rs1805874 and risk for Parkinson's disease (PD) in four Caucasian populations. This suggests the effect of calbindin on PD risk displays population specificity. PMID: 19674066
  13. calbindin may play a role in development of Purkinje cells located in heterotopias and cerebellar dysgenesias PMID: 20054781
  14. S-nitrosation of Ca(2+)-loaded and Ca(2+)-free recombinant calbindin D(28K) from human brain. PMID: 11994015
  15. binds to myo-inositol-1(or 4)-monophosphatase (IMPase) and increases the phosphatase activity PMID: 12176979
  16. calbindin 1, 28kDa may play a role in Ca2+ transport or cell development in human trophoblast possibly trough Ca2+ buffering PMID: 12606474
  17. The biological function of calbindin D28k appears to be tied to the redox state of its five cysteine residues. PMID: 15641794
  18. Post-translational modifications of human calbindin. PMID: 15741335
  19. Our findings indicate that the expression of parvalbumin or calbindin-D(28k) by subpopulations of dysplastic neurons in cortical tubers is aberrant and denotes dysfunctional inhibitory circuits inept for excitoprotection. PMID: 17156698
  20. aggregates of mutant ataxin-l may recruit calbindin-D28k via tissue transglutaminase 2 mediated covalent crosslinking PMID: 17442486
  21. recombinant human calbindin-D28k was crystallized at 291 K using PEG 3350 as precipitant and a 2.4 A resolution X-ray data set was collected from a single flash-cooled crystal PMID: 18259068
  22. calbindin D(28k) binds Zn2+ to 3 rather strong sites with dissociation constants in low micromolar range. Zn2+-bound state is structurally distinct from Ca2+-bound state, with negative allosteric interaction between Zn- & Ca-binding events. PMID: 18359862
  23. CALB1 is associated with Parkinson's disease independently of alpha-synuclein. PMID: 18568448
  24. No significant differences in cerebellar Purkinje cells in levels of CALB in autism or in the normal cerebellum. PMID: 18587625

Show More

Hide All

Protein Families
Calbindin family
Database Links

HGNC: 1434

OMIM: 114050

KEGG: hsa:793

STRING: 9606.ENSP00000265431

UniGene: Hs.65425

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*