Recombinant Human Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1)

In Stock
Code CSB-EP004469HU
Abbreviation Recombinant Human CAMK2N1 protein
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CAMK2N1
Uniprot No.
Research Area
Others
Alternative Names
CAMK2N1Calcium/calmodulin-dependent protein kinase II inhibitor 1; CaMKII inhibitory protein alpha; CaMKIIN-alpha
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-78aa
Target Protein Sequence
MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.6 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-Trx-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human CAMK2N1 contains amino acids 1-78. This CAMK2N1 protein is expected to have a theoretical molecular weight of 25.6 kDa. This CAMK2N1 recombinant protein is manufactured in e.coli. The N-terminal 6xHis-Trx tag was fused into the coding gene segment of CAMK2N1, making it easier to detect and purify the CAMK2N1 recombinant protein in the later stages of expression and purification.

Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1) is a protein involved in regulating calcium ion signal transduction, primarily participating in the regulation of the nervous system. One of its most significant research directions is the inhibitory role of CAMK2N1 in calcium/calmodulin-dependent protein kinase II (CAMKII) in the nervous system. CAMKII plays a crucial regulatory role in neurons, contributing to processes such as learning, memory, and neuron development. As an inhibitor of CAMKII, CAMK2N1 modulates the balance of calcium signals within neurons, playing a crucial role in the normal functioning of neural processes. In disease research, the association of CAMK2N1 with neurological diseases, especially neurodegenerative and psychiatric disorders, has attracted widespread attention.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Potent and specific inhibitor of CaM-kinase II (CAMK2).
Gene References into Functions
  1. CAMK2N1 expression is significantly downregulated in human masticatory mucosa during wound healing PMID: 28005267
  2. Hypermethylation of RUNX3/CAMK2N1 is associated with poor clinical outcome in Type II EOC, also after macroscopic complete resection. PMID: 26175272
  3. contributes to prostate cancer growth and survival through androgen receptor-dependent signaling PMID: 25296973
  4. Analyses suggest that CAMK2N1 plays a tumor suppressive role in prostate cancer cells. Reduced CAMK2N1 expression correlates to human prostate cancer progression and predicts poor clinical outcome. PMID: 25003983
  5. hCaMKIINalpha suppresses tumor growth by inducing cell cycle arrest via p27 stabilization PMID: 18305109

Show More

Hide All

Subcellular Location
Cell junction, synapse, synaptosome. Cell junction, synapse, postsynaptic density.
Protein Families
CAMK2N family
Tissue Specificity
Widely expressed. Nor detected in skeletal muscle.
Database Links

HGNC: 24190

OMIM: 614986

KEGG: hsa:55450

UniGene: Hs.731383

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*