Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Tags & Cell Markers
Alternative Names
CALL3_HUMAN; CALML3; Calmodulin like 3; Calmodulin related protein NB 1; Calmodulin-like protein 3; Calmodulin-related protein NB-1; CaM like protein; CaM-like protein; CLP; OTTHUMP00000019004
Species
Homo sapiens (Human)
Expression Region
1-149aa
Target Protein Sequence
MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human CALML3 contains amino acids 1-149. The calculated molecular weight for this CALML3 protein is 43.9 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of CALML3, making it easier to detect and purify the CALML3 recombinant protein in the later stages of expression and purification.
One of the primary research areas for Calmodulin-like protein 3 (CALML3) is cellular signal transduction and regulation. CALML3 serves as a mediator and modulator of calcium signals within cells, participating in the regulation of various cellular processes, including cell proliferation, differentiation, and apoptosis. In cancer research, the expression of CALML3 is associated with the occurrence and development of various tumors. Scientists are delving into understanding the specific functions of CALML3 in cancer cells to identify new approaches for cancer treatment. Additionally, CALML3 is implicated in research related to the cardiovascular system. Its regulatory role in cardiac muscle cells may play a crucial role in the onset of cardiovascular diseases. Relevant studies contribute to revealing the precise functions of CALML3 in cardiovascular health and disease.