Recombinant Human Calmodulin-like protein 3(CALML3)

Code CSB-EP004453HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P27482
Relevance May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP004453HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CALML3.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP004453HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CALML3.
Storage Buffer Tris-based buffer,50% glycerol
Alias CaM-like protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Research Area Tags & Cell Markers
Source E.coli
Gene Names CALML3
Protein Names Recommended name: Calmodulin-like protein 3 Alternative name(s): CaM-like protein Short name= CLP Calmodulin-related protein NB-1
Expression Region 1-149aa
Tag Info N-terminal GST-tagged
Mol. Weight 43.9kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.
Protein Families Calmodulin family
Tissue Specificity Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells.
Database Links

HGNC: 1452

OMIM: 114184

KEGG: hsa:810

STRING: 9606.ENSP00000315299

UniGene: Hs.239600

Pathway Calcium signaling pathway
cAMP signaling pathway
Estrogen signaling pathway
Melanogenesis
Vascular smooth muscle contraction
Cellular senescence
Ras signaling pathway
Apelin signaling pathway
cGMP-PKG signaling pathway
Glucagon signaling pathway
Insulin signaling pathway
Phosphatidylinositol signaling system
Rap1 signaling pathway
Neurotrophin signaling pathway

Related Products

CALML3 Antibodies

CALML3 Antibodies for Human

CALML3 Proteins

CALML3 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.