Recombinant Human Calmodulin-like protein 3 (CALML3)

In Stock
Code CSB-EP004453HU
Abbreviation Recombinant Human CALML3 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP004453HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CALML3.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP004453HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CALML3.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Tags & Cell Markers
Alternative Names
CALL3_HUMAN; CALML3; Calmodulin like 3; Calmodulin related protein NB 1; Calmodulin-like protein 3; Calmodulin-related protein NB-1; CaM like protein; CaM-like protein; CLP; OTTHUMP00000019004
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-149aa
Target Protein Sequence
MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.9kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human CALML3 contains amino acids 1-149. The calculated molecular weight for this CALML3 protein is 43.9 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of CALML3, making it easier to detect and purify the CALML3 recombinant protein in the later stages of expression and purification.

One of the primary research areas for Calmodulin-like protein 3 (CALML3) is cellular signal transduction and regulation. CALML3 serves as a mediator and modulator of calcium signals within cells, participating in the regulation of various cellular processes, including cell proliferation, differentiation, and apoptosis. In cancer research, the expression of CALML3 is associated with the occurrence and development of various tumors. Scientists are delving into understanding the specific functions of CALML3 in cancer cells to identify new approaches for cancer treatment. Additionally, CALML3 is implicated in research related to the cardiovascular system. Its regulatory role in cardiac muscle cells may play a crucial role in the onset of cardiovascular diseases. Relevant studies contribute to revealing the precise functions of CALML3 in cardiovascular health and disease.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.
Gene References into Functions
  1. Metformin suppresses gastric cancer through stimulating Calml3 secretion from TAFs. PMID: 30320344
  2. UVB irradiation induced increase in apoptosis, Reactive Oxygen Species production and Ca2+ concentration of human lens epithelial cells , in part, by downregulating the expression of CALML3 and involved oxidative stress, Ca2+, JNK1/2 and ERK1/2 signaling pathways, suggesting that investigating CALML3 may useful for developing cataract treatment. PMID: 29436594
  3. We identified calmodulin-like protein 3 (CALML3) as a key sensor of this SNP and a coregulator of ERalpha, which contributes to differential gene transcription regulation in an estrogen and SERM-dependent fashion. Furthermore, using CRISPR/Cas9-engineered ZR75-1 breast cancer cells with different ZNF423 SNP genotypes, striking differences in cellular responses to SERMs and PARP inhibitors, alone or in combination PMID: 28821270
  4. Loss of CALML3 predicts shorter overall and relapse-free survival in postoperative hepatocellular carcinoma (HCC) patients, thus providing a prognostic biomarker and therapy target in HCC. PMID: 29445139
  5. Increased CALML3 expression in suprabasal layers is characteristic for differentiating keratinocytes in normal epidermis, and nuclear expression of CALML3 inversely correlates with expression of the proliferation marker Ki-67. PMID: 23638045
  6. CLP may be required during terminal differentiation to increase myosin-10 function as cells migrate toward the upper layers and establish new adhesive contacts. PMID: 17130134
  7. increased CLP expression and CLP-mediated Myo10 function are important for skin differentiation and wound reepithelialization PMID: 18818677
  8. expression was readily detected in areas of normal oral mucosa, while a notable downregulation of expression occurred in areas of malignant transformation PMID: 19166543

Show More

Hide All

Protein Families
Calmodulin family
Tissue Specificity
Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells.
Database Links

HGNC: 1452

OMIM: 114184

KEGG: hsa:810

STRING: 9606.ENSP00000315299

UniGene: Hs.239600

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*