Recombinant Human Calmodulin-like protein 3(CALML3)

Code CSB-EP004453HU
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP004453HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CALML3.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP004453HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CALML3.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CALML3
Uniprot No. P27482
Research Area Tags & Cell Markers
Alternative Names CALL3_HUMAN; CALML3; Calmodulin like 3; Calmodulin related protein NB 1; Calmodulin-like protein 3; Calmodulin-related protein NB-1; CaM like protein; CaM-like protein; CLP; OTTHUMP00000019004
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-149aa
Target Protein Sequence MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 43.9kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function May function as a specific light chain of unconventional myosin-10 (MYO10), also enhances MYO10 translation, possibly by acting as a chaperone for the emerging MYO10 heavy chain protein. May compete with calmodulin by binding, with different affinities, to cellular substrates.
Gene References into Functions
  1. Metformin suppresses gastric cancer through stimulating Calml3 secretion from TAFs. PMID: 30320344
  2. UVB irradiation induced increase in apoptosis, Reactive Oxygen Species production and Ca2+ concentration of human lens epithelial cells , in part, by downregulating the expression of CALML3 and involved oxidative stress, Ca2+, JNK1/2 and ERK1/2 signaling pathways, suggesting that investigating CALML3 may useful for developing cataract treatment. PMID: 29436594
  3. We identified calmodulin-like protein 3 (CALML3) as a key sensor of this SNP and a coregulator of ERalpha, which contributes to differential gene transcription regulation in an estrogen and SERM-dependent fashion. Furthermore, using CRISPR/Cas9-engineered ZR75-1 breast cancer cells with different ZNF423 SNP genotypes, striking differences in cellular responses to SERMs and PARP inhibitors, alone or in combination PMID: 28821270
  4. Loss of CALML3 predicts shorter overall and relapse-free survival in postoperative hepatocellular carcinoma (HCC) patients, thus providing a prognostic biomarker and therapy target in HCC. PMID: 29445139
  5. Increased CALML3 expression in suprabasal layers is characteristic for differentiating keratinocytes in normal epidermis, and nuclear expression of CALML3 inversely correlates with expression of the proliferation marker Ki-67. PMID: 23638045
  6. CLP may be required during terminal differentiation to increase myosin-10 function as cells migrate toward the upper layers and establish new adhesive contacts. PMID: 17130134
  7. increased CLP expression and CLP-mediated Myo10 function are important for skin differentiation and wound reepithelialization PMID: 18818677
  8. expression was readily detected in areas of normal oral mucosa, while a notable downregulation of expression occurred in areas of malignant transformation PMID: 19166543

Show More

Hide All

Protein Families Calmodulin family
Tissue Specificity Expressed in normal mammary, prostate, cervical, and epidermal tissues. It is greatly reduced or undetectable in transformed cells.
Database Links

HGNC: 1452

OMIM: 114184

KEGG: hsa:810

STRING: 9606.ENSP00000315299

UniGene: Hs.239600

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1