Recombinant Human Calpastatin (CAST)

Code CSB-BP004561HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP004561HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP004561HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
CAST
Uniprot No.
Research Area
Neuroscience
Alternative Names
BS 17; Calpain inhibitor; Calpastatin; Cast; Heart type calpastatin ; ICAL_HUMAN; MGC9402; Sperm BS 17 component ; Sperm BS-17 component
Species
Homo sapiens (Human)
Expression Region
1-667aa
Target Protein Sequence
MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD
Mol. Weight
73.9kD
Protein Length
Partial of the full length of 1-708aa
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue.
Gene References into Functions
  1. single nucleotide polymorphisms in CAST gene confer risk for keratoconus susceptibility in Han Chinese population PMID: 29428799
  2. Kaposi sarcoma-associated herpesvirus reduces CAST (calpastatin) and consequently decreases ATG5 expression in both THP-1 monocytoid cells and primary monocytes. PMID: 27715410
  3. Loss of CAST in angiogenic ECs facilitates mu-calpain-induced SOCS3 degradation, which amplifies pathological angiogenesis through interleukin-6/STAT3/VEGF-C axis. PMID: 25648699
  4. We describe PLACK syndrome, as a clinical entity of defective epidermal adhesion, caused by loss-of-function mutations in calpastatin. PMID: 25683118
  5. Calpastatin binds with Cav1.2 amino acid motifs in a calcium dependent manner. PMID: 24462690
  6. Calpastatin gene (CAST) is not associated with late onset sporadic Parkinson's disease in the Han Chinese population. PMID: 23951044
  7. Linkage analysis and genetic association support involvement of CAST gene in the genetic susceptibility to keratoconus. PMID: 23449483
  8. Neuronal overexpression of calpastatin modulates amyloid precursor protein processing in brains of transgenic beta-amyloid depositing mice. PMID: 22206846
  9. Calpastatin overexpression reduces calpain-mediated proteolysis and behavioral impairment after traumatic brain injury. PMID: 22572592
  10. Mycoplasma hyorhinis membrane lipoproteins induce calpastatin upregulation in human cells PMID: 22288381
  11. calpastatin-calpain balance varied during Th-1,2, and -17 development; overexpression of a domain of calpastatin suppressed production of IL-6 and IL-17 by Th cells and of IL-6 by fibroblasts; suppression of IL-6 occurred by reducing NF-kappaB signaling PMID: 22046434
  12. The data supports the hypothesis that calpastatin may play a role in regulating the initial metastatic dissemination of breast cancer. PMID: 21531560
  13. calpain basal activity becomes measurable at a significant extent in peripheral blood mononuclear cells from cystic fibrosis patients due to a 40-60% decrease in both calpastatin protein and inhibitory activity PMID: 21983488
  14. CSL competes with CaM as a partial agonist for the site in the IQ domain in the C-terminal region of the Cav1.2 channel, which may be involved in activation of the channel. PMID: 21937422
  15. intervertebral discs at early stages of degeneration expressed low levels of calpastatin, and few cells expressed degenerative enzymes. At more advanced stages of degeneration, expression and number of cells immunopositive for calpastatin were higher PMID: 21839844
  16. Variations in CAST gene is associated with femoral neck Low bone mineral density. PMID: 21424381
  17. A confirmation study reports that a single nucleotide polymorphism and CAST are associated with Parkinson disease. PMID: 20127884
  18. involved in the proteolysis of amyloid precursor protein, which is thought to be abnormal in patients with Alzheimer's disease PMID: 11849768
  19. Overexpression of calpastatin reduced muscle atrophy during 10 day unloading period. Overexpression completely prevented shift in myofibrillar myosin content from slow to fast isoforms, which normally occurs in muscle unloading. PMID: 12482888
  20. insights into how the calpain/calpastatin network is spatially and temporally regulated in cells binding to the extracellular matrix PMID: 14559243
  21. Calpastatin amino acid side chains at leucine-11 and isoleucine-18 interact with hydrophobic pockets in calpain, and each of these interactions is indispensable for effective inhibition of calpain. PMID: 14992597
  22. Overexpression of calpastatin in transgenic mice is associated with an increase in GLUT4 protein. PMID: 15014085
  23. A complete calpain-calpastatin system is expressed in the human oocyte and may play a role in the various calcium-mediated processes occurring during activation of human oocytes. PMID: 15950654
  24. Results suggest a regulation on the calpain-calpastatin expression response to muscle damaging eccentric exercise, but not concentric exercise. PMID: 18340456
  25. genetically determined IL-1alpha levels may modulate transcription of calpain and calpastatin PMID: 18498295
  26. NMR data of calapastin tripartite binding mode to capain induced by calcium were presented. PMID: 18519038
  27. performed a full NMR assignment of hCSD1 to characterize it in its solution state PMID: 18537264
  28. Role of the calpain-calpastatin system in the density-dependent growth arrest. PMID: 18809371
  29. recruitment of calpastatin into aggregates allows translocation and activation of protease to the membranes; on the contrary, the presence of large amounts of calpastatin in the cytosol prevents both processes, protecting the cell from proteolysis PMID: 19103264
  30. Genome-wide association study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 18195134

Show More

Hide All

Involvement in disease
Peeling skin with leukonychia, acral punctate keratoses, cheilitis, and knuckle pads (PLACK)
Protein Families
Protease inhibitor I27 (calpastatin) family
Database Links

HGNC: 1515

OMIM: 114090

KEGG: hsa:831

UniGene: Hs.436186

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1