Recombinant Human Calpastatin (CAST)

In Stock
Code CSB-EP004561HU
Abbreviation Recombinant Human CAST protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
CAST
Uniprot No.
Research Area
Neuroscience
Alternative Names
BS 17; Calpain inhibitor; Calpastatin; Cast; Heart type calpastatin ; ICAL_HUMAN; MGC9402; Sperm BS 17 component ; Sperm BS-17 component
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-667aa
Target Protein Sequence
MNPTETKAVKTEPEKKSQSTKPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
75.9kDa
Protein Length
Full Length of isoform 4
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Calpastatin (CAST) is expressed in E. coli and includes the complete sequence of isoform 4, spanning amino acids 1 to 667. An N-terminal 6xHis tag is attached to the protein, which simplifies purification and detection processes. SDS-PAGE analysis confirms the product maintains purity levels exceeding 90%, making it well-suited for research applications that demand high-quality reagents.

Calpastatin functions as a specific inhibitor of calpain, a calcium-dependent cysteine protease. The protein appears to play a critical role in controlling calpain activity, which participates in various cellular processes—cytoskeletal remodeling and signal transduction pathways among them. Research into calpastatin's interactions and inhibitory mechanisms may prove essential for understanding cellular regulation and proteolytic balance.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Human Calpastatin is expressed in E. coli, a prokaryotic system that may not support proper folding of this large, multi-domain eukaryotic protein (667aa). Calpastatin requires specific domain folding to function as a calpain inhibitor, with its activity dependent on conformational flexibility and domain accessibility. While E. coli can express soluble proteins, the complex domain structure of calpastatin (particularly its four inhibitory domains) may not fold correctly without eukaryotic chaperones. The N-terminal 6xHis tag could potentially interfere with N-terminal function. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without functional validation (e.g., calpain inhibition assays).

1. Calpain-Calpastatin Interaction Studies

This application is highly dependent on correct folding. If calpastatin is properly folded, it can be used to study interactions with calpain-1/2 through binding kinetics and inhibition assays. However, if misfolded, the inhibitory domains may not interact correctly with calpains, leading to inaccurate binding data. The His-tag facilitates immobilization for SPR, but results require validation with functional inhibition assays. It should emphasize that activity verification is a prerequisite for meaningful interaction studies.

2. Antibody Development and Validation

This application is well-supported. The recombinant calpastatin can serve as an effective immunogen for antibody generation, as antibodies may recognize linear epitopes even if the protein is misfolded. The high purity (>85%) and full-length sequence ensure broad epitope coverage. However, antibodies may not recognize conformational epitopes of native calpastatin if folding is incorrect. Validation against endogenous calpastatin is recommended.

3. Protein-Protein Interaction Screening

This application carries a significant risk without folding validation. While pull-down assays are technically feasible with the His-tag, misfolded calpastatin may exhibit non-physiological interactions, potentially identifying false binding partners. This application should only be pursued after confirming native folding and calpain inhibitory activity.

4. Biochemical Characterization Studies

This application is appropriate and should be prioritized. Techniques like circular dichroism spectroscopy can directly assess secondary structure and folding quality. Thermal stability and pH sensitivity studies provide valuable data on the protein's biophysical properties. These studies are useful even if the protein is inactive, as they characterize the recombinant product.

Final Recommendation & Action Plan

Given the uncertainty in folding and bioactivity, the recommended approach is to first perform biochemical characterization (Application #4) to assess the protein's folding state, followed by functional validation using calpain inhibition assays. If the protein demonstrates inhibitory activity against calpain-1/2, it can be reliably used for interaction studies (Applications #1 and #3). For antibody development (Application #2), the protein can be used immediately, but the resulting antibodies should be validated against native calpastatin. Always include appropriate controls, such as active calpain enzymes and known calpastatin standards in functional assays. The E. coli expression system may produce functional calpastatin, but verification is essential given the protein's complexity and functional dependence on correct domain folding.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Recombinant proteins and the detection of TAAbs by ELISA

Review: All 15 proteins used in ELISA were purchased from CUSABIO (SF3B3, RUNX1T1, SARS, PAIP1, CAST, MAGEA12, CCDC6, RAD23A, NOL7, CRLF3, NAP1L4, SH2B1, LARP6, Wuhan, China). The scatter dot plot of the optical density (OD) values of ELISA for 8 TAAbs in the specific validation set.

By Anonymous

Target Background

Function
Specific inhibition of calpain (calcium-dependent cysteine protease). Plays a key role in postmortem tenderization of meat and have been proposed to be involved in muscle protein degradation in living tissue.
Gene References into Functions
  1. single nucleotide polymorphisms in CAST gene confer risk for keratoconus susceptibility in Han Chinese population PMID: 29428799
  2. Kaposi sarcoma-associated herpesvirus reduces CAST (calpastatin) and consequently decreases ATG5 expression in both THP-1 monocytoid cells and primary monocytes. PMID: 27715410
  3. Loss of CAST in angiogenic ECs facilitates mu-calpain-induced SOCS3 degradation, which amplifies pathological angiogenesis through interleukin-6/STAT3/VEGF-C axis. PMID: 25648699
  4. We describe PLACK syndrome, as a clinical entity of defective epidermal adhesion, caused by loss-of-function mutations in calpastatin. PMID: 25683118
  5. Calpastatin binds with Cav1.2 amino acid motifs in a calcium dependent manner. PMID: 24462690
  6. Calpastatin gene (CAST) is not associated with late onset sporadic Parkinson's disease in the Han Chinese population. PMID: 23951044
  7. Linkage analysis and genetic association support involvement of CAST gene in the genetic susceptibility to keratoconus. PMID: 23449483
  8. Neuronal overexpression of calpastatin modulates amyloid precursor protein processing in brains of transgenic beta-amyloid depositing mice. PMID: 22206846
  9. Calpastatin overexpression reduces calpain-mediated proteolysis and behavioral impairment after traumatic brain injury. PMID: 22572592
  10. Mycoplasma hyorhinis membrane lipoproteins induce calpastatin upregulation in human cells PMID: 22288381
  11. calpastatin-calpain balance varied during Th-1,2, and -17 development; overexpression of a domain of calpastatin suppressed production of IL-6 and IL-17 by Th cells and of IL-6 by fibroblasts; suppression of IL-6 occurred by reducing NF-kappaB signaling PMID: 22046434
  12. The data supports the hypothesis that calpastatin may play a role in regulating the initial metastatic dissemination of breast cancer. PMID: 21531560
  13. calpain basal activity becomes measurable at a significant extent in peripheral blood mononuclear cells from cystic fibrosis patients due to a 40-60% decrease in both calpastatin protein and inhibitory activity PMID: 21983488
  14. CSL competes with CaM as a partial agonist for the site in the IQ domain in the C-terminal region of the Cav1.2 channel, which may be involved in activation of the channel. PMID: 21937422
  15. intervertebral discs at early stages of degeneration expressed low levels of calpastatin, and few cells expressed degenerative enzymes. At more advanced stages of degeneration, expression and number of cells immunopositive for calpastatin were higher PMID: 21839844
  16. Variations in CAST gene is associated with femoral neck Low bone mineral density. PMID: 21424381
  17. A confirmation study reports that a single nucleotide polymorphism and CAST are associated with Parkinson disease. PMID: 20127884
  18. involved in the proteolysis of amyloid precursor protein, which is thought to be abnormal in patients with Alzheimer's disease PMID: 11849768
  19. Overexpression of calpastatin reduced muscle atrophy during 10 day unloading period. Overexpression completely prevented shift in myofibrillar myosin content from slow to fast isoforms, which normally occurs in muscle unloading. PMID: 12482888
  20. insights into how the calpain/calpastatin network is spatially and temporally regulated in cells binding to the extracellular matrix PMID: 14559243
  21. Calpastatin amino acid side chains at leucine-11 and isoleucine-18 interact with hydrophobic pockets in calpain, and each of these interactions is indispensable for effective inhibition of calpain. PMID: 14992597
  22. Overexpression of calpastatin in transgenic mice is associated with an increase in GLUT4 protein. PMID: 15014085
  23. A complete calpain-calpastatin system is expressed in the human oocyte and may play a role in the various calcium-mediated processes occurring during activation of human oocytes. PMID: 15950654
  24. Results suggest a regulation on the calpain-calpastatin expression response to muscle damaging eccentric exercise, but not concentric exercise. PMID: 18340456
  25. genetically determined IL-1alpha levels may modulate transcription of calpain and calpastatin PMID: 18498295
  26. NMR data of calapastin tripartite binding mode to capain induced by calcium were presented. PMID: 18519038
  27. performed a full NMR assignment of hCSD1 to characterize it in its solution state PMID: 18537264
  28. Role of the calpain-calpastatin system in the density-dependent growth arrest. PMID: 18809371
  29. recruitment of calpastatin into aggregates allows translocation and activation of protease to the membranes; on the contrary, the presence of large amounts of calpastatin in the cytosol prevents both processes, protecting the cell from proteolysis PMID: 19103264
  30. Genome-wide association study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 18195134

Show More

Hide All

Involvement in disease
Peeling skin with leukonychia, acral punctate keratoses, cheilitis, and knuckle pads (PLACK)
Protein Families
Protease inhibitor I27 (calpastatin) family
Database Links

HGNC: 1515

OMIM: 114090

KEGG: hsa:831

UniGene: Hs.436186

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*