Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8(CEACAM8)

In Stock
Code CSB-EP005168HU
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P31997
Lead Time 3-7 business days
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CD67 antigen Carcinoembryonic antigen CGM6 Non-specific cross-reacting antigen NCA-95 CD_antigen: CD66b
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Research Area Immunology
Source E.coli
Gene Names CEACAM8
Protein Names Recommended name: Carcinoembryonic antigen-related cell adhesion molecule 8 Alternative name(s): CD67 antigen Carcinoembryonic antigen CGM6 Non-specific cross-reacting antigen NCA-95 CD_antigen= CD66b
Expression Region 35-320aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 47.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Cell membrane, Lipid-anchor, GPI-anchor
Protein Families Immunoglobulin superfamily, CEA family
Tissue Specificity Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.
Database Links

HGNC: 1820

OMIM: 615747

KEGG: hsa:1088

STRING: 9606.ENSP00000244336

UniGene: Hs.41

Related Products

CEACAM8 Antibodies

CEACAM8 Antibodies for Human

CEACAM8 Antibodies for Homo sapiens (Human)

CEACAM8 Proteins

CEACAM8 Proteins for Homo sapiens (Human)

CEACAM8 ELISA Kit

CEACAM8 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.