Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Target Names

CASP10

Uniprot No.

Q92851

Research Area

Signal Transduction

Alternative Names

Apoptotic protease Mch-4;FAS-associated death domain protein interleukin-1B-converting enzyme 2;ICE-like apoptotic protease 4

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

220-415aa

Target Protein Sequence

VKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEAD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

54.2 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Involved in the activation cascade of caspases responsible for apoptosis execution. Recruited to both Fas- and TNFR-1 receptors in a FADD dependent manner. May participate in the granzyme B apoptotic pathways. Cleaves and activates caspase-3, -4, -6, -7, -8, and -9. Hydrolyzes the small- molecule substrates, Tyr-Val-Ala-Asp-|-AMC and Asp-Glu-Val-Asp-|-AMC.; Isoform 7 can enhance NF-kappaB activity but promotes only slight apoptosis.; Isoform C is proteolytically inactive.

Gene References into Functions

Caspase-10 is a negative regulator of cell death and a facilitator of gene induction separates the function of cFLIP and caspase-10 in the death-inducing signaling complex. PMID: 28445729
This study reveals an essential role of SUMOylated FADD in Drp1- and caspase-10-dependent necrosis. PMID: 27799292
Three cases of autoimmune lymphoproliferative syndrome due to somatic FAS mutation (ALPS-sFAS) combined with a germline CASP10 variation have been described. PMID: 26323380
Results showed miR-221/222 promote cell proliferation and repress apoptosis, through suppressing caspase-10, in prostate cancer cells. PMID: 26164758
Single nucleotide polymorphisms in CASP10 gene is associated with gastric cancer. PMID: 23921907
While myeloma cells require a basal level of autophagy for survival, caspase-10 tempers this response to avoid cell death. PMID: 23541952
This meta-analysis suggests that the rs13006529 T carrier in the CASP-10 gene might be a risk factor for cancer susceptibility, especially for breast cancer. PMID: 23212337
The protein factor-arrest 11 (Far11) is essential for the toxicity of human caspase-10 in yeast and participates in the regulation of autophagy and the DNA damage signaling. PMID: 22782902
induces apoptosis in avian virus H5N1-infected human monocyte-derived macrophages PMID: 21911414
Caspase-10 expression, measured by quantitative real-time RT-PCR, is a possible prognostic factor in patients with stage II colorectal cancer. PMID: 21559821
Caspase-10 isoforms play distinct and opposing roles in the initiation of death receptor-mediated tumour cell apoptosis. PMID: 21368896
The CASP10 V410I polymorphism was not associated with breast or ovarian cancer risk for BRCA1 or BRCA2 mutation carriers. PMID: 20978178
Data show that caspase-10 is the most active caspase in apoptotic erythroid progenitors induced by 11 kDa and NS1 as well as during B19V infection. PMID: 19861680
Somatic mutation of CASP10 is rare in colon, breast, lung, and hepatocellular carcinomas. PMID: 20025484
CASP10 mutation might contribute to the pathogenesis of factions of T-acute lymphoblastic leukaemia and multiple myeloma. PMID: 19900088
inactivating mutations in non-hodgkin lymphoma. PMID: 12010812
Caspase-10 is recruited to & activated at the native TRAIL and CD95 death-inducing signalling complexes in a FADD-dependent manner but can not functionally substitute caspase-8. Caspase-10 is cleaved during CD95-induced apoptosis of activated T cells. PMID: 12198154
histone H3 phosphoacetylation at the CASPASE-10 gene may play an important role in the induction of apoptosis in acute promyelocytic leukemia cells in response to arsenic trioxide PMID: 12388546
over-expression of GRB2 and FLICE2 in RA synovium is caused by TNF-alpha inducibility differentially regulated in RA synoviocytes and provide potential pathogenic roles of these genes in the hyperplasia of the RA synovium. PMID: 14687710
CASP10 levels are increased following DNA damage in a p53-dependent manner. PMID: 14688482
Re molecular requirements for neutrophil apoptosis: TNF-alpha-mediated apoptosis depends on the activation of caspase-8, spontaneous apoptosis requires the activation of caspase-10/b. PMID: 14761933
taxol induces FADD-dependent apoptosis primarily through activation of caspase-10 but independently of death receptors PMID: 15452117
a model in which caspase-10 is a crucial component during TRAIL-mediated apoptosis PMID: 15767684
Role of variants of caspase-10 in Autoimmune Lymphoproliferative Syndrome. PMID: 16446975
Altogether, these data indicate an active role for caspase-10 in cytotoxic drug-induced tumor cell death, downstream of the mitochondria. PMID: 16767158
These results suggest that caspase-10, DR-3 and IGFBP-3 are involved in apoptosis in the preeclamptic placenta. PMID: 17085968
A novel prodomain-only isoform of caspase-10 may preferentially play a regulatory role in NF-kappa B pathways. PMID: 17822854
Fas expression was reduced and caspase-10 activity was decreased in both patients PMID: 17999750
Caspase-10 expression was down-regulated in both rectal adenomas and cancers PMID: 18716417
Single nucleotide polymorphism data suggest a role for CASP10 as a potential modifier of the asthma phenotype, specifically with measures of airway obstruction and bronchial hyperresponsiveness. PMID: 18823309
the effect of the ectopic expression of the human initiator caspases-10 in Saccharomyces cerevisiae PMID: 19166881
Results show that heat shock protein 90 beta is cleaved by activated caspase-10 under UVB irradiation. PMID: 19380486

Hide All

Involvement in disease

Autoimmune lymphoproliferative syndrome 2A (ALPS2A); Familial non-Hodgkin lymphoma (NHL); Gastric cancer (GASC)

Protein Families

Peptidase C14A family

Tissue Specificity

Detectable in most tissues. Lowest expression is seen in brain, kidney, prostate, testis and colon.

Database Links

HGNC: 1500

OMIM: 601762

KEGG: hsa:843

STRING: 9606.ENSP00000286186

UniGene: Hs.5353

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP838815HU
Abbreviation	Recombinant Human CASP10 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Caspase-10 (CASP10), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage