Recombinant Human Cathelicidin antimicrobial peptide (CAMP)

Code CSB-EP004476HU
MSDS
Size US$88
Order now
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CAMP
Uniprot No.
Research Area
others
Alternative Names
18 kDa cationic antimicrobial protein; Antibacterial peptide LL-37; Antibacterial protein FALL-39; CAMP; CAMP_HUMAN; CAP 18; CAP-18; CAP18; Cathelicidin antimicrobial peptide; Cathelin-like protein; Cathelin-related antimicrobial peptide; CATHL3; Cationic antimicrobial protein; 18-KD; CLP; Cnlp; Cramp; CRAMP; mouse; homolog of; FALL 39 ; FALL-39 peptide antibiotic; FALL39 ; hCAP 18; hCAP-18; hCAP18; HSD26 ; LL37; MCLP; Peptide antibiotic; PR-39; porcine; homolog of
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
132-170AA
Target Protein Sequence
FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
24.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.
Gene References into Functions
  1. The correlation between serum LL-37 and high-density lipoprotein cholesterol levels suggests that LL-37 may play a key role in regulation of cholesterol levels in hypercholesterolemia. PMID: 29644526
  2. LL-37/CRAMP represents an important mediator of platelet activation and thrombo-inflammation. PMID: 29670076
  3. Low vitamin D3 status and higher systemic levels of LL-37 may be a consequence of reduced TB control and enhanced pathological inflammation. PMID: 29867045
  4. these data show that LL-37 affects surface and intracellular Toll-Like Receptor expression in tissue mast cells PMID: 29670923
  5. This review describes novel advances involving the roles and mechanisms of human cathelicidin LL-37 in cancer. PMID: 29843147
  6. this study shows that LL-37 serum level correlates with healing of venous leg ulcers PMID: 27663530
  7. Elevated serum levels of LL-37 in bipolar patients may suggest the role of this peptide in the pathomechanism of BD. PMID: 29239826
  8. LL-37 serum levels are not affected by body composition in elderly women with unipolar depression. PMID: 28959904
  9. The findings support a role for STAT3 and HIF-1A in the regulation of LL-37 expression. PMID: 27633343
  10. In silico docking study have confirmed the high binding affinities of multiple 9-mer peptides derived from LL-37 to the HLA-C*06:02 molecule proposed a mechanism of the interaction between this LL-37-HLA-C*06:02 complex and T cells via TCRs. PMID: 27189829
  11. IL-33 down-regulates the induction of hCAP-18/LL-37 production in human gingival epithelial cells. PMID: 28637951
  12. in teens with positive recto-vaginal group B streptococcus colonization, placental mRNA expression of cathelicidin is lower compared to those who tested negative for this infection PMID: 28622535
  13. Serum levels of LL-37 were found to be higher in elderly patients with major depressive disorder compared to controls. PMID: 28550757
  14. these results suggested that human CAMP/LL-37 might act as a tumor-suppressor in OSCC and DNA methylation might play roles during carcinogenesis via directly downregulating human CAMP promoter activity. PMID: 28427192
  15. omoted epithelial and smooth-muscle-like differentiation of Adipose-derived stem cells through activating the Wnt/beta-catenin and NF-kappaB pathways, respectively PMID: 29223160
  16. Patients with type 1 diabetes and presence of microangiopathy characterize higher level of serum cathelicidin. PMID: 28964758
  17. The expression of LL-37 was up-regulated in the inflamed mucosa of IBD patients. LL-37 was induced by TLR-3 stimulation and exhibited an anti-microbial effect via interaction with lipopolysaccharide (LPS). PMID: 28872665
  18. the mean level of LL-37 was statistically significantly higher in TB patients than that in patients with Gram-positive bacteria-induced pneumonia (p < 0.001), in patients with Gram-negative bacteria-induced pneumonia (p < 0.001), and in healthy controls (p < 0.001). PMID: 28956425
  19. data suggest that cathelicidin LL-37 is an important element of host defense in the course of bacterial diseases within the respiratory tract, particularly when the infection is caused by an intracellular pathogen. PMID: 28218580
  20. This review summarizes the current knowledge on molecular mechanisms underlying LL-37-induced receptor activation. PMID: 27609777
  21. L-CATH-2, D-CATH-2 and LL-37 can modulate the immune response of primary chicken immune cells by increasing mannose receptor expression, antigen presentation, endocytosis and neutralizing LPS-induced cytokine production and as a result augment activation of the adaptive immune system. PMID: 28715682
  22. study demonstrated a substantial loss of antimicrobial function when the peptide was exposed to low concentrations of nanomaterials, and further showed that the nanomaterial-peptide interaction resulted in a significant change in the structure of the peptide PMID: 28814602
  23. cathelicidin selectively modulated synthesis of TLR4 and 9 in intestinal epithelium, but only when cells were exposed to virulence factors, mostly from apical surfaces. PMID: 28988039
  24. Autologous endothelial progenitor cells transfected by lentiviral vectors expressing antibiotic peptide LL37, as well as urothelial and smooth muscle cells from New Zealand white male rabbits, were cultured and seeded onto preconfigured acellular collagen-based tubular matrices PMID: 28739721
  25. this study shows that LL-37 may aid clearance of influenza A virus by promoting monocyte uptake of the virus, while reducing viral replication and virus-induced TNF-a responses in these cells PMID: 27856789
  26. Male placental cotyledons showed reduced basal CYP27B1 and cathelicidin gene expression compared to females. PMID: 27210415
  27. Study demonstrates high levels of serum hBD2 and LL-37 levels in paediatric post- infectious bronchiolitis obliterans patients. These antimicrobial peptides may have important roles in immune systems and the pathogenesis of these patients. PMID: 26073571
  28. the expression of CAMP, vitamin D receptor (VDR), and the retinoid X receptor (RXR) isoforms in human skin and gingival tissue biopsies and investigated the signaling pathways involved in 1alpha,25-dihydroxyvitamin D3-induced upregulation of CAMP. PMID: 27357804
  29. A positive correlation was found between vitamin D and urine cathelicidin levels in the vitamin D sufficient group, however, there was no correlation between vitamin D and urine cathelicidin levels in the vitamin D insufficient group. PMID: 27180947
  30. LL37 induced YB1 expression, and increased tumor cell proliferation, migration and invasion of A375 and A875 malignant melanoma cell lines. PMID: 27922666
  31. this study shows that serum cathelicidin levels of acute asthma group are higher than controlled asthma group, and can be used to predict viral-induced acute asthma PMID: 27955890
  32. Our results suggest that calcitriol anti-cancer therapy is more likely to induce higher levels of CAMP in ERalpha- breast cancer cells, when compared to ERa + breast cancer cells. PMID: 27832772
  33. These findings highlight the role of cathelicidin in the pathogenesis of allergic rhinitis. PMID: 26777417
  34. expressions of LL-37 mRNA and protein in the lesions of cutaneous tuberculosis and tuberculids were similar to that of normal skin PMID: 26960373
  35. this study shows that carbamylation has profound and diverse effects on the structure and biological properties of LL-37. In some cases, anti-inflammatory LL-37 was rapidly converted to pro-inflammatory LL-37 PMID: 26878866
  36. In rhinovirus infected cystic fibrosis patients, LL37 was inversely correlated with viral load in bronchoalveolar lavage fluid. PMID: 26585423
  37. we discuss 1,25D3-induced down-regulation of cytokine/chemokine production and stimulation of hCAP-18/LL-37 gene expression which represent two very important pathways for 1,25D3-evoked regulation of the innate immune response--{REVIEW} PMID: 26433491
  38. this study provides evidence for the ability of LL37 to bind and internalize viral or endogenous DNA into non-immune cells. PMID: 26297208
  39. The human cathelicidin LL-37--A pore-forming antibacterial peptide and host-cell modulator. PMID: 26556394
  40. higher nasal levels are associated with protection against RSV infection, directly damages viral envelopes and disrupts viral particles PMID: 26873992
  41. Data indicate that endoplasmic reticulum (ER) stress increase sphingosine-1-phosphate (S1P) production, in turn activating nuclear factor kappa B (NF-kappaB)-mediated cathelicidin antimicrobial peptide (CAMP) synthesis. PMID: 26903652
  42. The authors show that the group A Streptococcus surface-associated M1 protein sequesters and neutralizes LL-37 antimicrobial activity through its N-terminal domain. PMID: 26468750
  43. Cathelicidin appears to play different roles in the development of pulmonary sarcoidosis and tuberculosis. PMID: 26422567
  44. Neonates with congenital pneumonia had significantly higher serum cathelicidin and lower serum 25(OH)D compared to controls. PMID: 25354286
  45. Taken together, these observations suggest that activation of human mast cells by LL-37 could be modified by TLR2 ligands and the function of human mast cells could be switched from allergic reactions to innate immune response. PMID: 26778002
  46. the use of hCAP-18 levels in blood plasma for differential diagnosis of neutropenic patients, was assessed. PMID: 26119962
  47. LL37, HMGB1 and S100A9 are increased in serum during exacerbation in COPD patients PMID: 25931489
  48. The aim of this project was to examine the functional impact of the human cathelicidin LL-37 and the mouse cathelicidin-related AMP (CRAMP) on the pathogenesis of lupus and arthritis. PMID: 25535966
  49. LL-37 interacts with negatively charged membranes forming a stable aggregate, which may produce toroidal pores. There is also an aggregate with a higher oligomeric degree for interaction of LL-37 with neutral membranes. PMID: 26502164
  50. Chlamydial plasmid-encoded virulence factor Pgp3 neutralizes the antichlamydial activity of human cathelicidin LL-37. PMID: 26416907

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Cathelicidin family
Tissue Specificity
Expressed in bone marrow and testis and neutrophils.
Database Links

HGNC: 1472

OMIM: 600474

KEGG: hsa:820

STRING: 9606.ENSP00000458149

UniGene: Hs.51120

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*