Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
18 kDa cationic antimicrobial protein; Antibacterial peptide LL-37; Antibacterial protein FALL-39; CAMP; CAMP_HUMAN; CAP 18; CAP-18; CAP18; Cathelicidin antimicrobial peptide; Cathelin-like protein; Cathelin-related antimicrobial peptide; CATHL3; Cationic antimicrobial protein; 18-KD; CLP; Cnlp; Cramp; CRAMP; mouse; homolog of; FALL 39 ; FALL-39 peptide antibiotic; FALL39 ; hCAP 18; hCAP-18; hCAP18; HSD26 ; LL37; MCLP; Peptide antibiotic; PR-39; porcine; homolog of
Species
Homo sapiens (Human)
Expression Region
132-170aa
Target Protein Sequence
FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 132-170 form the expressed segment for recombinant Human CAMP. The theoretical molecular weight of the CAMP protein is 24.7 kDa. The CAMP protein was expressed in e.coli. The N-terminal 10xHis-SUMO tag and C-terminal Myc tag was fused into the coding gene segment of CAMP, making it easier to detect and purify the CAMP recombinant protein in the later stages of expression and purification.
Cathelicidin antimicrobial peptide (CAMP) is a protein primarily studied in the fields of immunology and infectious diseases. Its pivotal role lies in the innate immune system, where it acts as a natural antibiotic, defending against microbial invaders. Researchers focus extensively on CAMP's involvement in combating bacterial, viral, and fungal infections, making it a key player in understanding host defense mechanisms. The most significant and widely explored area is its impact on antimicrobial activity, unveiling insights into potential therapeutic strategies against infectious diseases. Additionally, studies touch upon CAMP's contribution to inflammatory responses and its implications in various dermatological conditions, shedding light on skin immunity. While CAMP's main spotlight is on infection defense, its diverse roles across different immune processes hint at broader applications in medicine and immunotherapy.