Recombinant Human Cathelicidin antimicrobial peptide(CAMP)

Code CSB-EP004476HUb3
Product Type Recombinant Protein
Size US$1726
Uniprot No. P49913
Relevance Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 18 kDa cationic antimicrobial protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Research Area others
Source E.coli
Gene Names CAMP
Expression Region 132-170aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 24.7kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.
Subcellular Location Secreted
Protein Families Cathelicidin family
Tissue Specificity Expressed in bone marrow and testis and neutrophils.
Database Links

HGNC: 1472

OMIM: 600474

KEGG: hsa:820

STRING: 9606.ENSP00000458149

UniGene: Hs.51120

Pathway NOD-like receptor signaling pathway

Related Products

CAMP Antibodies

CAMP Antibodies for Homo sapiens (Human)

CAMP Proteins

CAMP Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.