Recombinant Human Cathelicidin antimicrobial peptide(CAMP)

Code CSB-EP004476HUb3
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names CAMP
Uniprot No. P49913
Research Area others
Alternative Names 18 kDa cationic antimicrobial protein; Antibacterial peptide LL-37; Antibacterial protein FALL-39; CAMP; CAMP_HUMAN; CAP 18; CAP-18; CAP18; Cathelicidin antimicrobial peptide; Cathelin-like protein; Cathelin-related antimicrobial peptide; CATHL3; Cationic antimicrobial protein; 18-KD; CLP; Cnlp; Cramp; CRAMP; mouse; homolog of; FALL 39 ; FALL-39 peptide antibiotic; FALL39 ; hCAP 18; hCAP-18; hCAP18; HSD26 ; LL37; MCLP; Peptide antibiotic; PR-39; porcine; homolog of
Species Homo sapiens (Human)
Source E.coli
Expression Region 132-170aa
Target Protein Sequence FALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 24.7kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Binds to bacterial lipopolysaccharides (LPS), has antibacterial activity.
Gene References into Functions
  1. The correlation between serum LL-37 and high-density lipoprotein cholesterol levels suggests that LL-37 may play a key role in regulation of cholesterol levels in hypercholesterolemia. PMID: 29644526
  2. LL-37/CRAMP represents an important mediator of platelet activation and thrombo-inflammation. PMID: 29670076
  3. Low vitamin D3 status and higher systemic levels of LL-37 may be a consequence of reduced TB control and enhanced pathological inflammation. PMID: 29867045
  4. these data show that LL-37 affects surface and intracellular Toll-Like Receptor expression in tissue mast cells PMID: 29670923
  5. This review describes novel advances involving the roles and mechanisms of human cathelicidin LL-37 in cancer. PMID: 29843147
  6. this study shows that LL-37 serum level correlates with healing of venous leg ulcers PMID: 27663530
  7. Elevated serum levels of LL-37 in bipolar patients may suggest the role of this peptide in the pathomechanism of BD. PMID: 29239826
  8. LL-37 serum levels are not affected by body composition in elderly women with unipolar depression. PMID: 28959904
  9. The findings support a role for STAT3 and HIF-1A in the regulation of LL-37 expression. PMID: 27633343
  10. In silico docking study have confirmed the high binding affinities of multiple 9-mer peptides derived from LL-37 to the HLA-C*06:02 molecule proposed a mechanism of the interaction between this LL-37-HLA-C*06:02 complex and T cells via TCRs. PMID: 27189829
  11. IL-33 down-regulates the induction of hCAP-18/LL-37 production in human gingival epithelial cells. PMID: 28637951
  12. in teens with positive recto-vaginal group B streptococcus colonization, placental mRNA expression of cathelicidin is lower compared to those who tested negative for this infection PMID: 28622535
  13. Serum levels of LL-37 were found to be higher in elderly patients with major depressive disorder compared to controls. PMID: 28550757
  14. these results suggested that human CAMP/LL-37 might act as a tumor-suppressor in OSCC and DNA methylation might play roles during carcinogenesis via directly downregulating human CAMP promoter activity. PMID: 28427192
  15. omoted epithelial and smooth-muscle-like differentiation of Adipose-derived stem cells through activating the Wnt/beta-catenin and NF-kappaB pathways, respectively PMID: 29223160
  16. Patients with type 1 diabetes and presence of microangiopathy characterize higher level of serum cathelicidin. PMID: 28964758
  17. The expression of LL-37 was up-regulated in the inflamed mucosa of IBD patients. LL-37 was induced by TLR-3 stimulation and exhibited an anti-microbial effect via interaction with lipopolysaccharide (LPS). PMID: 28872665
  18. the mean level of LL-37 was statistically significantly higher in TB patients than that in patients with Gram-positive bacteria-induced pneumonia (p < 0.001), in patients with Gram-negative bacteria-induced pneumonia (p < 0.001), and in healthy controls (p < 0.001). PMID: 28956425
  19. data suggest that cathelicidin LL-37 is an important element of host defense in the course of bacterial diseases within the respiratory tract, particularly when the infection is caused by an intracellular pathogen. PMID: 28218580
  20. This review summarizes the current knowledge on molecular mechanisms underlying LL-37-induced receptor activation. PMID: 27609777
  21. L-CATH-2, D-CATH-2 and LL-37 can modulate the immune response of primary chicken immune cells by increasing mannose receptor expression, antigen presentation, endocytosis and neutralizing LPS-induced cytokine production and as a result augment activation of the adaptive immune system. PMID: 28715682
  22. study demonstrated a substantial loss of antimicrobial function when the peptide was exposed to low concentrations of nanomaterials, and further showed that the nanomaterial-peptide interaction resulted in a significant change in the structure of the peptide PMID: 28814602
  23. cathelicidin selectively modulated synthesis of TLR4 and 9 in intestinal epithelium, but only when cells were exposed to virulence factors, mostly from apical surfaces. PMID: 28988039
  24. Autologous endothelial progenitor cells transfected by lentiviral vectors expressing antibiotic peptide LL37, as well as urothelial and smooth muscle cells from New Zealand white male rabbits, were cultured and seeded onto preconfigured acellular collagen-based tubular matrices PMID: 28739721
  25. this study shows that LL-37 may aid clearance of influenza A virus by promoting monocyte uptake of the virus, while reducing viral replication and virus-induced TNF-a responses in these cells PMID: 27856789
  26. Male placental cotyledons showed reduced basal CYP27B1 and cathelicidin gene expression compared to females. PMID: 27210415
  27. Study demonstrates high levels of serum hBD2 and LL-37 levels in paediatric post- infectious bronchiolitis obliterans patients. These antimicrobial peptides may have important roles in immune systems and the pathogenesis of these patients. PMID: 26073571
  28. the expression of CAMP, vitamin D receptor (VDR), and the retinoid X receptor (RXR) isoforms in human skin and gingival tissue biopsies and investigated the signaling pathways involved in 1alpha,25-dihydroxyvitamin D3-induced upregulation of CAMP. PMID: 27357804
  29. A positive correlation was found between vitamin D and urine cathelicidin levels in the vitamin D sufficient group, however, there was no correlation between vitamin D and urine cathelicidin levels in the vitamin D insufficient group. PMID: 27180947
  30. LL37 induced YB1 expression, and increased tumor cell proliferation, migration and invasion of A375 and A875 malignant melanoma cell lines. PMID: 27922666
  31. this study shows that serum cathelicidin levels of acute asthma group are higher than controlled asthma group, and can be used to predict viral-induced acute asthma PMID: 27955890
  32. Our results suggest that calcitriol anti-cancer therapy is more likely to induce higher levels of CAMP in ERalpha- breast cancer cells, when compared to ERa + breast cancer cells. PMID: 27832772
  33. These findings highlight the role of cathelicidin in the pathogenesis of allergic rhinitis. PMID: 26777417
  34. expressions of LL-37 mRNA and protein in the lesions of cutaneous tuberculosis and tuberculids were similar to that of normal skin PMID: 26960373
  35. this study shows that carbamylation has profound and diverse effects on the structure and biological properties of LL-37. In some cases, anti-inflammatory LL-37 was rapidly converted to pro-inflammatory LL-37 PMID: 26878866
  36. In rhinovirus infected cystic fibrosis patients, LL37 was inversely correlated with viral load in bronchoalveolar lavage fluid. PMID: 26585423
  37. we discuss 1,25D3-induced down-regulation of cytokine/chemokine production and stimulation of hCAP-18/LL-37 gene expression which represent two very important pathways for 1,25D3-evoked regulation of the innate immune response--{REVIEW} PMID: 26433491
  38. this study provides evidence for the ability of LL37 to bind and internalize viral or endogenous DNA into non-immune cells. PMID: 26297208
  39. The human cathelicidin LL-37--A pore-forming antibacterial peptide and host-cell modulator. PMID: 26556394
  40. higher nasal levels are associated with protection against RSV infection, directly damages viral envelopes and disrupts viral particles PMID: 26873992
  41. Data indicate that endoplasmic reticulum (ER) stress increase sphingosine-1-phosphate (S1P) production, in turn activating nuclear factor kappa B (NF-kappaB)-mediated cathelicidin antimicrobial peptide (CAMP) synthesis. PMID: 26903652
  42. The authors show that the group A Streptococcus surface-associated M1 protein sequesters and neutralizes LL-37 antimicrobial activity through its N-terminal domain. PMID: 26468750
  43. Cathelicidin appears to play different roles in the development of pulmonary sarcoidosis and tuberculosis. PMID: 26422567
  44. Neonates with congenital pneumonia had significantly higher serum cathelicidin and lower serum 25(OH)D compared to controls. PMID: 25354286
  45. Taken together, these observations suggest that activation of human mast cells by LL-37 could be modified by TLR2 ligands and the function of human mast cells could be switched from allergic reactions to innate immune response. PMID: 26778002
  46. the use of hCAP-18 levels in blood plasma for differential diagnosis of neutropenic patients, was assessed. PMID: 26119962
  47. LL37, HMGB1 and S100A9 are increased in serum during exacerbation in COPD patients PMID: 25931489
  48. The aim of this project was to examine the functional impact of the human cathelicidin LL-37 and the mouse cathelicidin-related AMP (CRAMP) on the pathogenesis of lupus and arthritis. PMID: 25535966
  49. LL-37 interacts with negatively charged membranes forming a stable aggregate, which may produce toroidal pores. There is also an aggregate with a higher oligomeric degree for interaction of LL-37 with neutral membranes. PMID: 26502164
  50. Chlamydial plasmid-encoded virulence factor Pgp3 neutralizes the antichlamydial activity of human cathelicidin LL-37. PMID: 26416907
  51. LL-37 modulates the response of macrophages during infection, controlling the expression of proinflammatory and anti-inflammatory cytokines. PMID: 26351280
  52. hCAP-18/LL-37 represents a previously unrecognised pancreatic ductal adenocarcinoma microenvironment factor that plays a critical role in pancreatic cancer stem cell-mediated tumourigenesis. PMID: 25841238
  53. lower LL-37 levels may be associated with the development of interstitial lung disease PMID: 25597616
  54. palmoplantar pustulosis vesicle fluid contains the proteinase required for LL-37 processing and also may directly upregulate IL-8 in lesional keratinocytes, in turn contributing to the subsequent inflammation of PPP lesional skin PMID: 25330301
  55. Data suggest that expression of cathelicidin and CYP24A1 (vitamin D3 24-hydroxylase) is up-regulated in placental extravillous trophoblasts by vitamin D metabolites 1,23-dihydroxyvitamin D3 and 25-hydroxyvitamin D3. PMID: 25596923
  56. Cathelicidin, expressed by immune cells in the tumor microenvironment, promotes colon cancer growth through activation of the PTEN/PI3K/Akt and Wnt/beta-catenin signaling pathways. PMID: 25596747
  57. Lipopolysaccharide phosphorylation by the WaaY kinase affects the susceptibility of Escherichia coli to the human antimicrobial peptide LL-37. PMID: 26100635
  58. LL37 is highly expressed in psoriasis skin. LL37 is a T-cell autoantigen in psoriasis. PMID: 25470744
  59. The results demonstrate that internalized LL-37 traffics to endosomes and lysosomes and contributes to intracellular clearance of bacteria by human macrophages, coinciding with increased reactive oxygen species and lysosome formation. PMID: 26116509
  60. dominant negative Brahma significantly inhibited C/EBPalpha as well as 1,25(OH)2D3 mediated induction of cathelicidin antimicrobial peptide transcription PMID: 25078430
  61. Hypoxia-inducible factor-1alpha (HIF-1alpha), a transcription factor important for activating innate immune effectors, and the antimicrobial peptide LL-37 (CRAMP in mice) are key determinants of C. albicans colonization resistance. PMID: 26053625
  62. hCAP18/LL-37 induces pro-inflammatory and pro-labour mediators, via the MyD88/NF-kappaB pathway. PMID: 25435436
  63. Cathelicidin LL-37 modulates the proinflammatory and proangiogenic effects of UV radiation and thereby contributes to enhanced sensitivity to sun exposure in rosacea. PMID: 25306296
  64. Review on the antibacterial activity of human cathelicidin-18 (LL-37). PMID: 25101632
  65. NETs treated with LL-37 are distinctly more resistant to S. aureus nuclease degradation than nontreated NETs. PMID: 25012862
  66. These data provide novel evidence that, in addition to its antimicrobial and other immunoregulatory functions, LL-37 contributes to cutaneous immunity by strengthening the skin's barrier function. PMID: 24862212
  67. Circulating levels of interferon- (IFN)-gamma, interleukin- (IL)-1RA, IL-2, and IL-23, and LL-37 were significantly higher in patients with psoriasis than in healthy controls. PMID: 25197165
  68. pulmonary TB patients with a vitamin D deficiency had significantly reduced local levels of the vitamin D-inducible antimicrobial peptide LL-37 in granulomatous lesions compared to distal parenchyma from the infected lung. PMID: 25510482
  69. the effect of pH on the activity of an ASL defensin, human beta-defensin-3 (hBD-3), and the cathelicidin-related peptide, LL-37. We found that reducing pH from 8.0 to 6.8 reduced the ability of both peptides to kill Staphylococcus aureus. PMID: 25512526
  70. These data demonstrate inducible expression of hCAP18/LL-37 in the female lower reproductive tract. PMID: 25089904
  71. Signal transduction by LL-37 through CsrS reflects a direct ligand/receptor interaction. PMID: 25378408
  72. LL-37 induced TACE and EGFR activation, as well as TGF-alpha and MUC5AC mucin production by NCI-H292 cells. PMID: 24901072
  73. Cathelicidin LL-37 forms oligomers with a loose hydrophobic core in physiological solutions which persists in biological membranes. PMID: 25378136
  74. After adjustment for age, race, sex, and HIV duration, the association between LL-37 and CD4 remained significant. HIV and/or HIV-related variables may alter the expected positive relationship between vitamin D and LL-37. PMID: 24798231
  75. CAMP induces IL-36gamma expression leading to initiation of skin inflammation and occasional exacerbations of psoriasis. PMID: 25305315
  76. These findings demonstrate that a localized gene therapy with LL-37 is a promising approach for the treatment of wounds PMID: 24394186
  77. The concentrations of LL37, alpha-1, beta-1 and beta-2 defensins were determined by ELISA. Serum AMPs did not change during attacks and did not correlate with acute phase reactants. PMID: 24747281
  78. Report elevated LL-37 levels in bronchoalveolar lavage fluid from children with pulmonary tuberculosis. PMID: 24903937
  79. These data provide the experimental evidence that telomere shortening and related inflammatory proteins are associated with human IgAN, and it could be a new direction for the disease progression study. PMID: 24903994
  80. Competition assays, cross-linking experiments, limited proteolysis, and mass spectrometry revealed that LL-37 binds by specific hydrophobic interactions to the His-40-Lys-50 segment of actin, located in the DNase I binding loop. PMID: 24947511
  81. LL-37 peptide enhanced signal transduction by Toll-like receptor 3 is regulated by pH. PMID: 25092290
  82. A model of LL-37 bound to DNA was generated, which reveals amino termini alpha-helices of dimerized LL-37 bind the major groove of DNA, with numerous DNA contacts made by LL-37 basic residues. PMID: 24763694
  83. These findings indicate that LL-37 favorably induces IL-8 expression and secretion in HGECs, suggesting both direct and indirect involvement of LL-37 in neutrophil recruitment into an inflammatory site within diseased periodontal tissues. PMID: 25268344
  84. Physiological concentrations of the human host defense peptide LL-37 promote virulence factor production as well as an adaptive resistance against fluoroquinolone and aminoglycoside antibiotics in P. aeruginosa PAO1. PMID: 24349231
  85. LL-37 elicits a biphasic release of eicosanoids in macrophages with early, Ca(2+)-dependent formation of LTB4 and TXA2 followed by a late peak of TXA2, generated via induction of COX-2 by internalized LL-37. PMID: 24736410
  86. Polymorphism in cathelicidin gene (CAMP) that alters Hypoxia-inducible factor (HIF-1alpha::ARNT) binding is not associated with tuberculosis. PMID: 23953711
  87. LL-37 and its derivatives may contribute to the control of immune-mediated inflammatory diseases. PMID: 24666281
  88. LL-37 potently inhibits the LPS/ATP-induced pyroptosis by both neutralizing the action of LPS and inhibiting the response of P2X7 to ATP. PMID: 24454930
  89. Besides its antimicrobial activity against bacteria, fungi, and viruses, LL-37 plays a role in chemotaxis, immunomodulation, wound healing, angiogenesis, apoptosis, & tumor surveillance. PMID: 23246832
  90. Untreated HIV infection may contribute to lower LL-37 levels, independent of vitamin D levels. ART treatment may potentially mitigate this decrease in LL-37 levels. PMID: 24821067
  91. Data suggest that serum levels of cathelicidin LL37 and IFN-alpha may reflect both local renal inflammation and systemic inflammation. PMID: 24286516
  92. Citrullination alters immunomodulatory function of LL-37 essential for prevention of endotoxin-induced sepsis. PMID: 24771854
  93. LL-37 played an important role in DNA-triggered inflammation. Thus, we have identified a link between cytosolic DNA, LL-37 and autoinflammation in cholesteatoma, providing new potential targets for the treatment of this disease. PMID: 24383796
  94. LL-37 enhances the mucus production in chronic obstructive pulmonary disease (COPD) airways, thus contributing to the progression of COPD. PMID: 24291709
  95. These results indicate that Neisseria meningitidis selectively exploits the epithelial microenvironment in order to protect itself from LL-37 via a RhoA and Cdc42 mediated mechanism. PMID: 23834289
  96. visfatin enhances CAMP, hBD-2, hBD-3, and S100A7 production in human keratinocytes and their orthologs in murine imiquimod-treated psoriatic skin. PMID: 23499548
  97. LL-37 forms amphipathic helical structures and self-assembles under physiological conditions. PMID: 24117320
  98. In psoriasis patients with co-morbidities, the blood levels of cathelicidin were higher compared to controls. PMID: 23760318
  99. Our data suggest that the human cathelicidin may be further developed for sensitizing resistant cancer cells to chemotherapy. PMID: 23274176
  100. Human monocytic cells, whose CAMP production is up-regulated by 1,25(OH)2D3-vitamin D receptor pathway, accelerate antimicrobial function of autophagolysosome in Mycobacterium marinum infection. PMID: 23452544

Show More

Hide All

Subcellular Location Secreted
Protein Families Cathelicidin family
Tissue Specificity Expressed in bone marrow and testis and neutrophils.
Database Links

HGNC: 1472

OMIM: 600474

KEGG: hsa:820

STRING: 9606.ENSP00000458149

UniGene: Hs.51120

Most popular with customers

  Tel: 301-363-4651
  Email: support@cusabio.com
  Distributors Worldwide

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1