Recombinant Human Cathepsin O(CTSO)

In Stock
Code CSB-EP006203HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P43234
Lead Time 3-7 business days
Relevance Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV
Research Area Cell Biology
Source E.coli
Gene Names CTSO
Protein Names CTSO1
Expression Region 108-321aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 28.5 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Proteolytic enzyme possibly involved in normal cellular protein degradation and turnover.
Subcellular Location Lysosome
Protein Families Peptidase C1 family
Tissue Specificity Expressed in all tissues examined. High levels seen in the ovary, kidney and placenta while low levels seen in thymus and skeletal muscle.
Database Links

HGNC: 2542

OMIM: 600550

KEGG: hsa:1519

STRING: 9606.ENSP00000414904

UniGene: Hs.75262

Pathway Apoptosis

Related Products

CTSO Antibodies

CTSO Antibodies for Homo sapiens (Human)

CTSO Proteins

CTSO Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.