Recombinant Human Cation-independent mannose-6-phosphate receptor (IGF2R), partial

Code CSB-YP011093HU
Abbreviation Recombinant Human IGF2R protein, partial
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transport
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
628-772aa
Target Protein Sequence
LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.7 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The generation of the recombinant human cation-independent mannose-6-phosphate receptor (IGF2R) with a C-terminal 6xHis-Myc-tag is accomplished using an efficient yeast expression system. The process involves cloning the gene fragment encoding the 628-772aa of the human IGF2R into a specialized expression vector. This vector contains a C-terminal 6xHis-Myc-tag, which is designed to facilitate easy purification and detection of the recombinant protein. After introducing the constructed vector into yeast cells through transfection, transfected cells are selected. Large-scale culture of the transfected yeast cells is established to allow for optimal protein expression. The expressed recombinant IGF2R protein is then harvested from the cell lysate and subjected to purification techniques, ensuring a high level of purity. SDS-PAGE analysis confirms the protein's purity, which exceeds 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates the transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelysosomal compartment where the low pH mediates the dissociation of the complex. The receptor is then recycled back to the Golgi for another round of trafficking through its binding to the retromer. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation by binding DPP4.
Gene References into Functions
  1. M. tuberculosis-initiated human mannose receptor signaling regulates macrophage recognition and vesicle trafficking by gamma Fc receptors, Grb2, and SHP-1. PMID: 28978467
  2. IGF2R deletion is associated with motor speech disorders, and language delays. PMID: 28767196
  3. Heterodimers of the SNX-BAR proteins, SNX1, SNX2, SNX5, and SNX6, are the cargo-selective elements that mediate the retrograde transport of CI-MPR from endosomes to the trans-Golgi networ independently of the core retromer trimer. PMID: 28935632
  4. Sequence-dependent cargo recognition by SNX-BARs mediates retromer-independent transport of CI-MPR. PMID: 28935633
  5. Findings indicate that IGF2R expression is controlled posttranscriptionally by two factors that associate with Igf2r mRNA and suggest that miR-195 and CUGBP1 dampen IGF signaling by inhibiting IGF2R translation. PMID: 28716948
  6. Data show one single nucleotide polymorphism (SNP) in Fox transcription factor FOXO3 (FOXO3) was significantly associated with longevity, and the six SNPs in proto-oncogene protein AKT1 (AKT1) gene and in IGF-2 Receptor (IGF-2R) gene are not. PMID: 26683100
  7. CREB plays an important role in the inhibition of IGF2R expression by binding to the IGF2R promoter and further suppresses H9c2 cardiomyoblast cell apoptosis induced by IGF2R signaling under hypoxic conditions. PMID: 26610485
  8. This study showed that Plasma IGF2R levels were positively correlated with plasma HIV viral load. PMID: 25890304
  9. IGF2R gene polymorphism and circulating IGF2R are associated with T2DM PMID: 25922844
  10. The macrophage-specific markers CD163, soluble CD163, and soluble MR are increased in septic patients. PMID: 24637679
  11. Results show that insulin-like growth factor II (IGF-II) overexpression enhanced the levels of amyloid precursor protein (APP) in SK-N-AS neuroblastoma cells. PMID: 25939386
  12. IGF2R silencing significantly enhanced the chemo-resistance of NSCLC cell lines to cisplatin treatment. PMID: 25402559
  13. Report genes involved in trafficking of the mannose 6-phosphate receptors between the trans-Golgi network, endosomes and the plasma membrane. PMID: 25278553
  14. CD222 specifically controls the balance between active and inactive Lck in resting T cells, which guarantees operative T cell effector functions. PMID: 25127865
  15. Synergistic interactions were detected between SNPs, including a non-synonymous SNP, and diplotypes within IGF2R and ADAMTS19 which may contribute to POF. PMID: 24014609
  16. AGE-RAGE-induced oxidative stress stimulates the release of endothelial cell DPP-4, which could in turn act on ECs directly via the interaction with M6P/IGF-IIR, further potentiating the deleterious effects of AGEs. PMID: 23984879
  17. The ubiquitin ligase RNF126 has a role in the retrograde sorting of the CI-MPR. PMID: 24275455
  18. these data suggest that M6P/IGF-IIR silencing alone is insufficient to confer a tumorigenic phenotype, but can enhance tumorigenicity in an already transformed cell. PMID: 23686499
  19. Results showed that insulin-like growth factor 2 ApaI and IFG2R Gly1619Arg gene polymorphisms are not associated with male infertility. PMID: 23539881
  20. The mannose 6-phosphate-binding sites of M6P/IGF2R determine its capacity to suppress matrix invasion by squamous cell carcinoma cells. PMID: 23347038
  21. Data indicate that the levels of IGF-2R and IGFBP-2 in hepatocellular carcinoma (HCC) tissues were higher than those in adjacent tissues. PMID: 23071652
  22. The 5-phosphatase OCRL mediates retrograde transport of the mannose 6-phosphate receptor by regulating a Rac1-cofilin signalling module. PMID: 22907655
  23. demonstrate that functional mannose 6-phosphate(M6P)-binding sites are important for the anti-invasive properties of M6P/IGF2R PMID: 22521359
  24. M6P/IGF2R truncation mutants may contribute to the cancer phenotype by decreasing the availability of full-length M6P/IGF2Rs to perform tumor-suppressive functions such as binding/internalization of receptor ligands PMID: 22681933
  25. Serum IGF-2R levels were significantly higher in heart failure patients than in non-failing controls. After heart transplantation, serum IGF-2R levels increased, peaked at the first month, and decreased to near pre-transplantation levels at 6 months. PMID: 21895964
  26. M6P-IGF2R appears to control plasminogen activation within cells that might be important to restrict plasmin activity to specific sites and substrates. PMID: 22613725
  27. SNP at 8q24 makes diabetes a risk factor of colorectal cancer via IGF2R, especially in genetically non-risk allele cases. PMID: 22486879
  28. No evidence that the IGF2R Gly1619Arg variation is associated with recurrent spontaneous abortions. PMID: 21627551
  29. Data suggest that soluble CREG protein can exert its biological function via glycosylation-independent binding to the extracellular domains 11-13 of cell surface M6P/IGF2R, modulating SMC phenotypic switching from contractile to proliferative. PMID: 21195083
  30. Leu(27)IGF2 promoted mitogenesis and survival only in explants with intact IGF2R expression. PMID: 20980691
  31. M6P/IGF2R may be involved in HBV-associated hepatocarcinogenesis by the regulation of its expression level. PMID: 12736721
  32. Imprinting of IGF2R gene in human is polymorphic, with a minority of individuals showing exclusive expression from the maternal allele. PMID: 8267611
  33. IGF-2R gene polymorphisms are associated with the susceptibility and pathological development of hepatocellular carcinoma. PMID: 20119675
  34. IGFIIR/M6PR is nutritionally regulated independently of IGF-II. PMID: 20110184
  35. Importance of widening the epigenetic investigation of growth restriction to include multiple imprinted loci and highlights potential involvement of the IGF2R locus. PMID: 20104244
  36. The 1.4 A resolution crystal structure of domain 11 was solved using the anomalous scattering signal of sulfur. It consists of two crossed beta-sheets forming a flattened beta-barrel with a putative IGF-II binding site is at one end. PMID: 11867533
  37. cDNA probes were used to analyze the gene expression of IGF type 2 receptor in luteinized granulosa cells from different-sized follicles after ovarian hyperstimulation. PMID: 12005306
  38. blocks apoptosis induced by herpes simplex virus 1 mutants lacking glycoprotein D and is likely the target of antiapoptotic activity of the glycoprotein. PMID: 12021353
  39. Results suggest that M6P/IGF2R functions as a growth suppressor and its loss or mutation may contribute to development and progression of cancer. PMID: 12149131
  40. Results suggest that a defect in a post-transcriptional process may exist during synthesis of the M6P/IGF2R in breast cancer cells, leading to failure to express sufficient functional M6P/IGF2R and resulting in the hypersecretion of procathepsin D. PMID: 12165733
  41. 1,25(OH)(2)D(3) treatment of Caco-2 cells results in activation of latent TGF-beta 1 facilitated by the enhanced expression of IGF-II receptor PMID: 12223346
  42. findings are consistent with the hypothesis that the insulin-like growth factor-II/mannose 6-phosphate receptor suppresses tumor growth PMID: 12399424
  43. data suggest that the insulin-like growth factor-II- and Mannose-6-Phosphate-binding functions of the insulin-like growth factor 2 receptor have opposing activities, with respect to growth of prostate cancer cells PMID: 12586773
  44. the interaction between uPAR and Man-6-P/IGF2R is a low percentage binding event and that suPAR and full-length uPAR bind the Man-6-P/IGF2R by different mechanisms. PMID: 12665524
  45. defect in USF function may contribute to down-regulation of IGF2R expression in cancer cells. PMID: 12857727
  46. neutralization of serum IGF-II by sCIMPR plays a major role in IL-6-type cytokine-dependent cell proliferation. PMID: 12959977
  47. The insulin-like growth factor receptor (IGF-IR) disruption may constitute an effective tool for the control of neovascularization PMID: 14710346
  48. Review delineates what is currently known about IGF-II/M6P receptor structure, its ligand binding properties and role in lysosomal enzyme transport. It also summarizes the recent data regarding the role of the receptor in the central nervous system. PMID: 15003389
  49. Nay play a direct role in tumour suppression or an indirect role as a transporter for ligands designated for degradation in the lysosomes. (review) PMID: 15156403
  50. Increased frequency of the cation dependent-MPR C-allele in patients with major depression, but no involvement in Alzheimer disease noted. PMID: 15167696

Show More

Hide All

Subcellular Location
Golgi apparatus membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein.
Protein Families
MRL1/IGF2R family
Database Links

HGNC: 5467

OMIM: 147280

KEGG: hsa:3482

STRING: 9606.ENSP00000349437

UniGene: Hs.487062

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*