Recombinant Human Chromogranin-A(CHGA)

Code CSB-EP005344HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P10645
Relevance Pancreastatin: Strongly inhibits glucose induced insulin release from the pancreas.Catestatin: Inhibits catecholamine release from chromaffin cells and noradrenergic neurons by acting as a non-competitive nicotinic cholinergic antagonist . Displays antibacterial activity against Gram-positive bacteria S.aureus and M.luteus, and Gram-negative bacteria E.coli and P.aeruginosa . Can induce mast cell migration, degranulation and production of cytokines and chokines . Acts as a potent scavenger of free radicals in vitro . May play a role in the regulation of cardiac function and blood pressure .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Pituitary secretory protein I ;SP-I
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG
Research Area Cancer
Source E.coli
Gene Names CHGA
Expression Region 19-457aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 52.9kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Pancreastatin
Subcellular Location Cytoplasmic vesicle, secretory vesicle lumen, Cytoplasmic vesicle, secretory vesicle membrane, Secreted, Note=Associated with the secretory granule membrane through direct interaction to SCG3 that in turn binds to cholesterol-enriched lipid rafts in intragranular conditions, SUBCELLULAR LOCATION: Serpinin: Secreted, Cytoplasmic vesicle, secretory vesicle
Protein Families Chromogranin/secretogranin protein family
Tissue Specificity GE-25 is found in the brain.
Database Links

HGNC: 1929

OMIM: 118910

KEGG: hsa:1113

STRING: 9606.ENSP00000216492

UniGene: Hs.150793

Q&A and Customer Reviews

Q&A
Q:

I have a few questions regarding the CSB-EP005344HU:
1.Previously, we received the information which this product was GST tag fusion protein in 2015 however this was changed and we received a 6x His-tag fusion
Would you happen to know when the tag of this product was changed from GST to 6×His Tag? Do you have a list of products that changed from GST tag to His Tag?
2. It was written "Molecular Weight:52.9 kDa" in the datasheet. We think that this molecular weight is full length human Chromogranin-A. But this product isn't full length human Chromogranin-A and is Expression Data:19-457aa. Can you please clarify?

A:
Thanks for your inquiry. Actually we provide two kinds of tags for this protein. The following are the details of the two kinds of tagged proteins in our newest developed protein catalog.
1. Code: CSB-EP005344HU
Name: Recombinant Human Chromogranin-A(CHGA)
Expression Region: 19-457aa, Full Length
Tag Info: N-terminal 6xHis-tagged
Expression Sequence:

LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG


Molecular Weight: 52.9 kDa
Note: The region 19-457aa is actually the full length protein, because the signal peptide will be removed for full length of mature protein.
2. Code: CSB-EP005344HU1
Name: Recombinant Human Chromogranin-A(CHGA),partial
Expression Region: 224-457aa, Partial
Tag Info: N-terminal GST-tagged
Expression Sequence:

QAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG


Molecular Weight: 53.4 kDa
However, from 2015 to 2017, our coding rule has changed several times.
In "CUSABIO Developed Protein Catalog 20170803" (Newest Version), we use CSB-EP005344HU for the N-terminal 6xHis-tagged protein and CSB-EP005344HU1 for the N-terminal GST-tagged protein.
In "CUSABIO Developed Protein Catalog 20170321", we used CSB-EP005344HU for the N-terminal 6xHis-tagged protein and CSB-EP005344HU(1) for the N-terminal GST-tagged protein.
In "CUSABIO Developed Protein Catalog 20160316", we used CSB-EP005344HU for the N-terminal 6xHis-tagged protein and CSB-EP005344HU(G) for the N-terminal GST-tagged protein.
On May 3rd, 2017, you used CSB-EP005344HU to place the order, so we prepare this protein with N-terminal 6xHis-tagged.
For your future orders, could you please list tag type and expression region in your PO?
So we could confirm whether the product information is consistent with our newest version and provide you the correct product you want.
Customer Reviews

Related Products

CHGA Antibodies

CHGA Antibodies for Homo sapiens (Human)

CHGA Antibodies for Human

CHGA Proteins

CHGA Proteins for Homo sapiens (Human)

CHGA ELISA Kit

CHGA ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.