Code | CSB-EP005344HU |
MSDS | |
Size | $224 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
The DNA sequence containing the gene coding for 19-457aa of human chromogranin-A/CHGA was used to express recombinant CHGA protein in E.coli cells. The recombinant CHGA protein was fused with a 6xHis-tag at the N-terminus for purification. According to the SDS-PAGE analysis, a molecular mass band of about 51-65 kDa of the CHGA protein was visualized on the gel. The purity of this CHGA protein is greater than 90%. Apart from being as an immunogen for antibody generation, this recombinant protein also may be used in the CHGA-associated cancer studies.
CHGA is a member of the granin family of neuroendocrine secretory proteins located in the secretory vesicles of neurons and endocrine cells. Its main function is in the granulogenesis of vesicle formation. CHGA acting as the precursor synthesizes many functional peptides such as catestatin, vasostatin, and parastatin. CHGA is often secreted by neuroendocrine tumors (NETs), and measurement of serum CHGA is a sensitive and effective noninvasive laboratory test for the clinical detection and management of NETs if other non-NET physiological, pathological, and pharmacological causes are excluded or considered in the interpretation.
There are currently no reviews for this product.
I have a few questions regarding the CSB-EP005344HU:
1.Previously, we received the information which this product was GST tag fusion protein in 2015 however this was changed and we received a 6x His-tag fusion
Would you happen to know when the tag of this product was changed from GST to 6×His Tag? Do you have a list of products that changed from GST tag to His Tag?
2. It was written "Molecular Weight:52.9 kDa" in the datasheet. We think that this molecular weight is full length human Chromogranin-A. But this product isn't full length human Chromogranin-A and is Expression Data:19-457aa. Can you please clarify?
LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG
QAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG