Recombinant Human Cofilin-2 (CFL2)

Code CSB-EP005281HU
Abbreviation Recombinant Human CFL2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
CFL 2; CFL2; COF2_HUMAN; Cofilin 2 muscle; Cofilin; Cofilin muscle; Cofilin muscle isoform; Cofilin-2; Cofilin2; muscle isoform; NEM 7; NEM7
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-166aa
Target Protein Sequence
MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.7kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. Its F-actin depolymerization activity is regulated by association with CSPR3. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods. Required for muscle maintenance. May play a role during the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere.
Gene References into Functions
  1. Here we report atomic-level characterization by magic angle spinning (MAS) NMR of the muscle isoform of human cofilin 2 (CFL2) bound to F-actin. We demonstrate that resonance assignments for the majority of atoms are readily accomplished and we derive the intermolecular interface between CFL2 and F-actin. PMID: 28303963
  2. The secreted levels of the cofilin-2 protein in radioresistant NPC patients were significantly higher than those of radiosensitive cases. PMID: 29664897
  3. miR-3189-3p mimics enhanced the effects of the S100A4 siRNA on the inhibition of gastric cancer cell proliferation and migration by targeting CFL2. PMID: 29342841
  4. The greatest levels of circulating miR-297 and miR-19b-3p with its common target CFL2 are associated with metastatic prostate cancer. PMID: 28091918
  5. The serum lever of Alzheimer's disease were increase and the expression of clf2 strongly correlated with the Mini-Mental State Examination scores of the AD patients PMID: 25502766
  6. In primary tumours, both desmin and CFL2 expression predicted improved overall survival in multivariate analyses PMID: 24889065
  7. Cofilin 2 phosphorylation and genetic overexpression plays a role in the pathogenesis of idiopathic dilated cardiomyopthay. PMID: 25814227
  8. patients with severe nemaline myopathy should be screened for mutations in CFL2. PMID: 24610938
  9. A novel homozygous missense mutation in exon 2 (c.19G>A, p.Val7Met) of CFL2 was identified in two siblings with congenital myopathy. PMID: 22560515
  10. the cofilin-induced change in the filament twist is due to a unique conformation of the actin molecule unrelated to any previously observed state PMID: 22158895
  11. PHD2 affects cell migration and F-actin formation via RhoA/rho-associated kinase-dependent cofilin phosphorylation PMID: 20801873
  12. FXa-mediated sustained cofilin inactivation leads to stabilization of actin filaments incompatible with migration PMID: 20347121
  13. actin depolymerizing factor/cofilins play an active role in establishing new interprotomer interfaces in F-actin that substitute for disrupted or weakened (as in ADP-actin) longitudinal contacts in filaments PMID: 16530787
  14. CFL2, encoding the actin-binding protein muscle cofilin-2, is mutated in two siblings with congenital myopathy. PMID: 17160903
  15. Resting T cells from infected patients carry significantly higher levels of active cofilin. PMID: 18928553
  16. MLP binds directly to CFL2 in human cardiac and skeletal muscles. PMID: 19752190

Show More

Hide All

Involvement in disease
Nemaline myopathy 7 (NEM7)
Subcellular Location
Nucleus matrix. Cytoplasm, cytoskeleton.
Protein Families
Actin-binding proteins ADF family
Tissue Specificity
Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.
Database Links

HGNC: 1875

OMIM: 601443

KEGG: hsa:1073

STRING: 9606.ENSP00000298159

UniGene: Hs.180141

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*