Recombinant Human Cold-inducible RNA-binding protein(CIRBP)

Code CSB-EP613483HUe0
Product Type Recombinant Protein
Size US$1726
Uniprot No. Q14011
Relevance Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs), when overexpressed.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias A18 hnRNP Glycine-rich RNA-binding protein CIRP
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names CIRBP
Expression Region 1-172aa
Tag Info N-terminal GST-tagged
Mol. Weight 45.6kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor (By similarity). Promotes assembly of stress granules (SGs), when overexpressed.
Subcellular Location Nucleus, nucleoplasm, Cytoplasm
Tissue Specificity Ubiquitous.
Database Links

HGNC: 1982

OMIM: 602649

KEGG: hsa:1153

STRING: 9606.ENSP00000322887

UniGene: Hs.618145

Related Products

CIRBP Antibodies

CIRBP Antibodies for Homo sapiens (Human)

CIRBP Antibodies for Human

CIRBP Proteins

CIRBP Proteins for Homo sapiens (Human)

CIRBP ELISA Kit

CIRBP ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.