Recombinant Human Collagen alpha-1 (IV) chain (COL4A1), partial

In Stock
Code CSB-EP005741HU1c7
Abbreviation Recombinant Human COL4A1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Source
E.coli
Expression Region
30-167aa
Target Protein Sequence
GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.8 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.; Arresten, comprising the C-terminal NC1 domain, inhibits angiogenesis and tumor formation. The C-terminal half is found to possess the anti-angiogenic activity. Specifically inhibits endothelial cell proliferation, migration and tube formation.
Gene References into Functions
  1. USP8 deubiquitinates Sec31A and inhibits the formation of large COPII carriers, thereby suppressing collagen IV secretion. PMID: 29604273
  2. It seems that CD14 gene polymorphism might be associated with the risk of CAD, whereas COL4A1 gene polymorphism was not found to confer any risk of CAD PMID: 29299748
  3. these data indicated that COL4A1 may confer trastuzumab resistance in gastric cancer. PMID: 29512712
  4. VIPAR, with its partner proteins, regulate sorting of lysyl hydroxylase 3 (LH3, also known as PLOD3) into newly identified post-Golgi collagen IV carriers PMID: 27435297
  5. Our study showed that the rs544012 AC and rs679505 AA genotypes were independently associated with the risk of ICH in the Chinese Han population and that the AA haplotype (rs3742207-rs11069830) in the COL4A1 gene may be related to the risk of ICH in the Chinese Han population PMID: 29360590
  6. The rs532625 AA genotype in the COL4A1 gene was independently associated with the risk of disability and death in a Chinese Han population following intracerebral hemorrhage. PMID: 29477007
  7. this study shows that COL4A1 production by urothelial carcinoma of the bladder plays a pivotal role in tumor invasion through the induction of tumor budding PMID: 28415608
  8. Genotype-phenotype correlations in pathology caused by COL4A1 and COL4A2 mutations have been summarized. (Review) PMID: 27794444
  9. Urine levels of COL4A1, COL13A1, the combined values of COL4A1 and COL13A1 (COL4A1 + COL13A1), and CYFRA21-1 were significantly elevated in urine from patients with BCa compared to the controls. A high urinary COL4A1 + COL13A1 was found to be an independent risk factor for intravesical recurrence. PMID: 28837258
  10. Building collagen IV smart scaffolds on the outside of cells has been summarized. (Review) PMID: 28845540
  11. Our findings extend the spectrum of COL4A1 mutations linked with renal disease and demonstrate that the highly conserved C-terminal part of the NC1 domain of the alpha1 chain of type IV collagen is important in the integrity of glomerular basement membrane in humans. PMID: 27190376
  12. Twist1 appears to require both palladin and collagen alpha1(VI) as downstream effectors for its prometastatic effects, which could be future therapeutic targets in cancer metastasis. PMID: 26973246
  13. only collagen-IV elicits the formation of proteolytically active podosomes through a mechanism involving increased Src phosphorylation, p190RhoGAP-B (also known as ARHGAP5) relocalisation and MT1-MMP (also known as MMP14) cell surface exposure at podosome sites. PMID: 27231093
  14. Mutations upregulating COL4A1 expression lead topontine autosomal dominant microangiopathy with leukoencephalopathy (PADMAL). PMID: 27666438
  15. The study shows an association of the COL4A1 gene with cerebral palsy and suggests a potential role of COL4A1 in the pathogenesis of this disease. PMID: 26748532
  16. Differential protein expression of collagen IV, laminin alpha2, and nidogen-1 indicated basal lamina remodeling develops in ischemic failing versus nonfailing human hearts. PMID: 26756417
  17. COL4A1 expression is significantly upregulated in human masticatory mucosa during wound healing. PMID: 28005267
  18. pulmonary complications should be considered in patients with COL4A1 mutation-related disorders. PMID: 28017902
  19. Chromosomal analysis and array-CGH showed no aberration. Target capture sequencing for COL4A1 and COL4A2 revealed a de novo COL4A1 mutation (c.2123G>T [p.Gly708Val]). PMID: 26879631
  20. In porencephaly subjects with COL4A1 mutation, we did not detect significant alterations of immunofluorescence patterns in basal membranes of different skin structures. Heterozygous COL4A1 G749S mutation is associated with a normal immunofluorescence pattern of skin basement membranes. PMID: 26686511
  21. High serum Collagen Type IV is associated with ovarian and breast cancer. PMID: 26406420
  22. Hydroxylation and O-linked glycosylation sites in col4a1 from human lens capsule. PMID: 26593852
  23. plasma levels increased in second and third trimester pre-eclampsia PMID: 26343951
  24. SMAD3 is a necessary factor for TGFbeta-mediated stimulation of mRNA and protein expression of type IV collagen genes in human vascular smooth muscle cells; it regulates expression of COL4a1 and COL4a2 PMID: 26310581
  25. COLIV is a promising tumour marker for CLM and can possibly be used to detect postoperative CLM recurrence. The combination of COLIV and CEA is superior to either marker alone in detecting CLM PMID: 26162539
  26. analysis of the unique AAB composition and chain register for a heterotrimeric type IV collagen model peptide COL4a1/COL4a2 containing a natural interruption site PMID: 26209635
  27. The catalytic domain of peroxidasin and its immunoglobulin (Ig) domains are required for efficient sulfilimine bond formation. PMID: 26178375
  28. Studied the role of alpha1 and alpha2 chains of type IV collagen in UIP; found type IV collagen deposition in early fibrotic lesions of UIP may be implicated in refractory pathophysiology including migration of lesion fibroblasts via a FAK pathway. PMID: 26006016
  29. The expression of collagen type IV and its alpha chains (alpha1-6) was investigated in different endothelial cell culture systems in vitro qualitatively and quantitatively. PMID: 23551189
  30. Silencing the Col4-alpha1 gene or disrupting integrin engagement by blocking the antibody reduced the expression of platelet-derived growth factor A (PDGF-A), a potent chemotactic factor for fibroblasts. PMID: 25686533
  31. A girl with porencephaly and an episode of microangiopathic hemolysis in infancy and her father with HANAC, both of whom had a heterozygous missense mutation of COL4A1, are reported. PMID: 25425218
  32. This study expands the spectrum of COL4A1 phenotypes and indicates screening in patients with anophthalmia/microphthalmia regardless of MRI findings or presumed inheritance pattern. PMID: 24628545
  33. Type IV collagen is an activating ligand for the adhesion G protein-coupled receptor GPR126. PMID: 25118328
  34. The molecular basis of familial retinal arteriolar tortuosity was identified for the first time, thus expanding the human phenotypes linked to COL4A1 mutations. PMID: 25228067
  35. Examined association between COL4A1 SNPs and intracranial aneurysms in Japanese cohort. PMID: 19506372
  36. p53 directly activated transcription of the COL4A1 gene by binding to an enhancer region 26 kb downstream of its 3' end and increased the release of Arresten in the extracellular matrix. PMID: 22253229
  37. Haploinsufficiency for COL4A1, rather than a dominant-negative effect of mutations, may cause intracerebral hemorrhage and white matter disease. PMID: 23065703
  38. The novel mutation (c.2345 G > C) of the COL4A1 gene is the first report of a non-syndromic, autosomal dominant congenital cataract, thereby highlighting the important role of type IV collagen in the physiological and optical properties of the lens. PMID: 25124159
  39. The whole exome sequencing showed no pathological mutations of COL4A1 and COL4A2 in fetal intraventricular hemorrhage PMID: 24317722
  40. carbohydrate moiety (alpha-Gal) on laminin gamma-1 and collagen alpha-1 (VI) chain are possibly common IgE-reactive proteins in the Japanese patients with beef allergy PMID: 24180678
  41. the integrin signaling pathway activated in a tumor environment with collagen deposition is responsible for low cell elasticity and high metastatic ability. PMID: 24823860
  42. Both rs605143 and rs565470 of COL4A1gene are associated with coronary artery disease in the Uygur population of China. PMID: 24156251
  43. Data indicate that the aberrantly methylated and expressed genes in cancer process including IRS1 and collagen-related genes COL4A1, COL4A2 and COL6A3. PMID: 23818951
  44. In families where anterior segment dysgenesis occurs together with cerebral hemorrhages, genetic analysis of COL4A1 should be considered. PMID: 23394911
  45. These data suggest novel roles for arresten in the regulation of oral squamous carcinoma cell proliferation, survival, motility and invasion through the modulation of cell differentiation state and integrin signaling. PMID: 23227231
  46. Studies indicate that progenitor endothelial cells (ECs), endothelial colony-forming cells (ECFCs), deposit collagen IV, fibronectin, and laminin. PMID: 22919069
  47. COL4A1 mutations have been identified in adult patients with cerebral small vessel diseases. PMID: 22868088
  48. COL4A1 mutations are associated with schizencephaly and hemolytic anemia; genetic testing for COL4A1 should be considered for children with these conditions. PMID: 23225343
  49. This study demonistrated that patients with COL4A1 mutations raised creatine kinase and cerebral calcification. PMID: 22932948
  50. The data suggested that miR-21 is involved in the regulation of the synthesis of COL4A1, a component of the basement membrane surrounding the GC layer and granulosa-embedded extracellular structure. PMID: 22573493

Show More

Hide All

Involvement in disease
Brain small vessel disease with or without ocular anomalies (BSVD); Hereditary angiopathy with nephropathy aneurysms and muscle cramps (HANAC); Porencephaly 1 (POREN1); Intracerebral hemorrhage (ICH); Tortuosity of retinal arteries (RATOR); Schizencephaly (SCHZC)
Subcellular Location
Secreted, extracellular space, extracellular matrix, basement membrane.
Protein Families
Type IV collagen family
Tissue Specificity
Highly expressed in placenta.
Database Links

HGNC: 2202

OMIM: 120130

KEGG: hsa:1282

STRING: 9606.ENSP00000364979

UniGene: Hs.17441

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*