Recombinant Human Complement receptor type 1 (CR1), partial

In Stock
Code CSB-EP005932HUe1
Abbreviation Recombinant Human CR1 protein, partial
MSDS
Size $390
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
C3b/C4b receptor;CD antigen CD35
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
41-234aa
Target Protein Sequence
GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.6 kDa
Protein Length
Partial
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Membrane immune adherence receptor that plays a critical role in the capture and clearance of complement-opsonized pathogens by erythrocytes and monocytes/macrophages. Mediates the binding by these cells of particles and immune complexes that have activated complement to eliminate them from the circulation. Acts also in the inhibition of spontaneous complement activation by impairing the formation and function of the alternative and classical pathway C3/C5 convertases, and by serving as a cofactor for the cleavage by factor I of C3b to iC3b, C3c and C3d,g, and of C4b to C4c and C4d. Plays also a role in immune regulation by contributing, upon ligand binding, to the generation of regulatory T cells from activated helper T cells.; (Microbial infection) Acts as a receptor for Epstein-Barr virus.
Gene References into Functions
  1. this study correlated phenotype data (CR1 density per erythrocyte (CR1/E), blood soluble CR1 (sCR1)) with genetic data (density/length polymorphisms) in AD patients and healthy controls.. PMID: 30044434
  2. CR1 rs1704660G, rs17047661G and rs6691117G variants were significantly associated with Chagas disease. PMID: 29323238
  3. Meta-analysis validated the association of late onset Alzheimer disease with CR1 (rs6656401) variants. PMID: 29504051
  4. rs6656401 CR1 is not associated with late-onset Alzheimer's disease. PMID: 28477215
  5. CR1 plays a vital role in Alzheimer's disease pathology and disease progression. PMID: 26742530
  6. the effect of CR1 rs3818361 polymorphism on Alzheimer's disease (AD) risk in Chinese cohorts is consistent with the increased risk observed in European AD cohorts. PMID: 26189835
  7. Genetic variation within the CR1 gene is associated with inflammation and the risk of incident coronary artery disease. PMID: 28033544
  8. The distribution of the CR1 alleles, genotypes and haplotypes differed significantly among population in Brazil, Vietnam, India, Republic of Congo and Ghana. PMID: 28520715
  9. CD16 and CD35 are important for neutrophil internalization of M. tuberculosis, whereas HIV-1 infection adversely affects opsonophagocytosis. PMID: 27258232
  10. This study demonstrates an up-regulation of complement regulatory proteins, CD35 and CD55 in HIV associated pre-eclamptic compared to normotensive pregnancy. PMID: 27521598
  11. Although B lymphocytes of active systemic lupus erythematosus (SLE) patients express lower level of CR1, the inhibitory capacity of this complement receptor is still maintained and its ligand-induced clustering results in significant inhibition of the main B cell functions, similar to that found in the case of healthy individuals. PMID: 27981054
  12. CyaA binding did not trigger downstream signaling of CR3 in human monocytes and CyaA-catalyzed elevation of cAMP effectively blocked CR3 signaling initiated by a natural ligand. PMID: 26650353
  13. the Putative Role of CR1 in Alzheimer's Disease PMID: 26914463
  14. Knops blood group antigen a/b genotype was associated with increased susceptibility to severe malaria and the b/b genotype was associated with reduced risk of severe malaria. PMID: 25916414
  15. The C4d/CR1 ratio is a simple and quickly determinable biomarker that enables the differentiation between infection and flare-up in febrile SLE patients at initial evaluation. PMID: 26273660
  16. This meta-analysis further supports previous findings that CR1 rs6656401 polymorphism contributes to Alzheimer's Disease susceptibility. PMID: 24878768
  17. Complement receptor type 1 (CR1/CD35) expressed on activated human CD4+ T cells contributes to generation of regulatory T cells PMID: 25742728
  18. These results provide a framework for understanding how loss of CR1 expression on podocytes may contribute to complement-mediated damage in the kidney. PMID: 26260209
  19. findings provide evidence that the A carrier (AG/GG) and the A allele of the ECR1 A3650G polymorphism may be correlated to the pathogenesis of NRDS and, hence, might be involved in the susceptibility to NRDS. PMID: 25494101
  20. THE COMBINATION OF EXPRESSION OF MARKERS CR1 AND CR2 (CD35/CD21) IN DIAGNOSTIC OF B-CELL LYMPHOPROLIFERATIVE DISEASES PMID: 26189291
  21. CR1 gene rs2274567 G/A, rs4844600 G/A, and rs2296160 C/T polymorphisms may not be involved in susceptibility to malaria in Chinese population. PMID: 25683978
  22. In addition to being a risk factor for Alzheimer's disease development, a CR1 SNP appears to be associated with higher rates of medium-term disease progression PMID: 24998857
  23. Data indicate that complement activation promote complement component 3 C3b deposition on native and acetylated LDL and binding to the complement receptor 1 (CR1). PMID: 25349208
  24. A meta-analysis demonstrated significant associations of both the CR1 rs6656401 and CR1 rs3818361 polymorphisms with late-onset Alzheimer's disease susceptibility. PMID: 24996192
  25. CR1 SNPs correlates with specific aspects of cognitive impairment in Alzheimer's disease patients. PMID: 24530172
  26. This study identified nominally significant or suggestive associations between the LOAD-risky CR1 variants and worse Logical Memory immediate recall scores in blacks. PMID: 23643458
  27. Increased CR1 expression was associated with histology classification. PMID: 23464487
  28. CR1 rs7525160 G > C polymorphism was associated with an increased risk of developing non-small cell lung cancer in Chinese population PMID: 24621201
  29. Polymorphism of the complement receptor 1 gene correlates with the hematologic response to eculizumab in patients with paroxysmal nocturnal hemoglobinuria. PMID: 24038027
  30. this is the first study to elucidate the relationship of the L-CR1 transcript with the disease activity of RA patients. PMID: 24433281
  31. Using mutagenesis and structural biology to map the binding site for the Plasmodium falciparum merozoite protein PfRh4 on the human immune adherence receptor. PMID: 24214979
  32. Maternal coding variants in complement receptor 1 is associated with spontaneous idiopathic preterm birth. PMID: 23591632
  33. two Alzheimer's disease-associated CR1 variants, rs6656401 and rs3818361, are associated with major recurrent depression in females in a population-based cohort using individuals from the Generation Scotland: Scottish Family Health Study PMID: 22244847
  34. It did not explain (part of) the association of genome wide association top single-nucleotide polymorphisms rs3818361/rs6656401, nor of the CR1copy number variation, with Alzheimer disease in our cohort PMID: 23582656
  35. ATP release following CR1 ligation increases the mobility of the lipid fraction of RBC membranes, which in turn facilitates CR1 clustering, and thereby enhances the binding avidity of complement-opsonized particles to the RBC CR1. PMID: 24022490
  36. Data show that increased CD35, CD46, CD55 and CD59 on neutrophils and monocytes present potent markers of bacterial infection and viral infection. PMID: 23376460
  37. The CD35 antigen bounds gp350/220 and became latently infected when the fusion receptor HLA II was coexpressed. PMID: 23416052
  38. Genome-wide association studies found 3 new susceptibility loci for Alzheimer disease(AD): complement receptor 1,clusterin,and the phosphatidylinositol-binding clathrin assembly protein. These SNPS are not associated with AD in a Polish population. PMID: 23650005
  39. Our findings suggest complex mechanisms underlying the interaction of CR1, APOE, and brain amyloid pathways in Alzheimer disease PMID: 23022416
  40. Complement receptor type 1 (CR1, CD35) is a potent inhibitor of B-cell functions in rheumatoid arthritis patients. PMID: 22962438
  41. We identified rare small events overlapping CR1 and BIN1 in Alzheimer's disease and normal controls with opposite copy number variation dosage. PMID: 23202439
  42. Malaria inhibits surface expression of complement receptor 1 in monocytes/macrophages, causing decreased immune complex internalization. PMID: 23440418
  43. There are fewer mono- or dinucleated, but dramatically more numbers of tri- or polynucleated megakaryocytes in the bone marrow of transgenic Crry mice. PMID: 23390291
  44. Common CR1 variants significantly protect against severe malaria in an endemic area. PMID: 23152904
  45. In conclusion, despite there are some limitations, this meta-analysis indicates that the A allele of the CR1 SNP rs6656401 is significantly associated with LOAD susceptibility in Chinese Han populations. PMID: 22960360
  46. The clustering phenomenon of CR1 in erythrocytes is identified in electron microscopy. PMID: 22374251
  47. our results support that the CR1-S isoform explains the GWAS signals and open a novel prospect for the investigation of CR1-related disease mechanisms. PMID: 22819390
  48. Simultaneous quantitative analysis of CD64 and CD35 expression on neutrophils might be useful to distinguish between bacterial and viral infections in rheumatoid arthritis patients. PMID: 22237765
  49. CR1 (CD35) and CR3 (CD11b/CD18) act in concert for phagocytosis of opsonized Francisella tularensis by human neutrophils. PMID: 22888138
  50. CLU and CR1 were associated with more rapid cognitive decline. PICALM was associated with an earlier age at midpoint of cognitive decline. PMID: 22952074

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Receptors of complement activation (RCA) family
Tissue Specificity
Present on erythrocytes, a subset of T cells, mature B cells, follicular dendritic cells, monocytes and granulocytes.
Database Links

HGNC: 2334

OMIM: 120620

KEGG: hsa:1378

STRING: 9606.ENSP00000356016

UniGene: Hs.334019

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*