Tel : 301-363-4651 Professional and Accurate! We are your good partner in biology research.

Product Name:

Recombinant Human Connective tissue growth factor(CTGF),partial

Product Type : Recombinant Protein
Code : CSB-RP094244h
Size : Pls inquiry other sizes
Uniprot NO. : P29279
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Relevance : Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
Image :
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References : Connective tissue growth factor a cysteine-rich mitogen secreted by human vascular endothelial cells is related to the SRC-induced immediate early gene product CEF-10.Bradham D.M., Igarashi A., Potter R.L., Grotendorst G.R.J. Cell Biol. 114:1285-1294(1991)
Storage Buffer : Tris-based buffer,50% glycerol
Alias : CCN family member 2Hypertrophic chondrocyte-specific protein 24Insulin-like growth factor-binding protein 8 ;IBP-8 ;IGF-binding protein 8 ;IGFBP-8
Species : Homo sapiens (Human)
Purity : Greater than 90% as determined by SDS-PAGE.
Sequence : GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Research Area : Immunology
Protocol :
Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.
Source : E.coli
Gene Names : CTGF
Expression Region : 253-349aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info :
Mol. Weight : 38.1kDa
Protein Description : Partial
Contact us

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2015 www.cusabio.com Cusabio Biotech Co., Ltd All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.