Recombinant Human DNA-binding protein inhibitor ID-2

Product Type Recombinant Protein
Uniprot No. Q02363
Species Homo sapiens (Human)
Research Area Epigenetics and Nuclear Signaling
Gene Names ID2
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Target Details This protein belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene.
HGNC 5361
RGD 2859
MGI 96397
Function Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Restricts the CLOCK and ARNTL/BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock
Subcellular Location Cytoplasm, Nucleus
Tissue Specificity Highly expressed in early fetal tissues, including those of the central nervous system.
Database Links

HGNC: 5361

OMIM: 600386

KEGG: hsa:3398

STRING: 9606.ENSP00000234091

UniGene: Hs.180919

Pathway Hippo signaling pathway
TGF-beta signaling pathway
Signaling pathways regulating pluripotency of stem cells

Product Details for Different Expression Systems

Product Name Recombinant Human DNA-binding protein inhibitor ID-2,Yeast
Code CSB-YP010967HU
Size Pls inquiry other sizes
Source Yeast
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Expression Region 1-134aa
Protein Description Full length
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human DNA-binding protein inhibitor ID-2,Baculovirus
Code CSB-BP010967HU
Size Pls inquiry other sizes
Source Baculovirus
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Expression Region 1-134aa
Protein Description Full length
Still Have Questions? Leave a Message or Start an on-line Chat
Product Name Recombinant Human DNA-binding protein inhibitor ID-2,Mammalian cell
Code CSB-MP010967HU
Size Pls inquiry other sizes
Source Mammalian cell
Purity >85% (SDS-PAGE)
Tag Info The following tags are available.
N-terminal His-tagged and C-terminal Myc-tagged
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Sequence MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Expression Region 1-134aa
Protein Description Full length
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

ID2 Antibodies

ID2 Antibodies for Homo sapiens (Human)

ID2 Antibodies for Human

ID2 Proteins

ID2 Proteins for Homo sapiens (Human)

ID2 ELISA Kit

ID2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.