Recombinant Human DNA excision repair protein ERCC-1 (ERCC1)

Code CSB-EP007769HU
Abbreviation Recombinant Human ERCC1 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-297aa
Target Protein Sequence
MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.5 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Non-catalytic component of a structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair. Responsible, in conjunction with SLX4, for the first step in the repair of interstrand cross-links (ICL). Participates in the processing of anaphase bridge-generating DNA structures, which consist in incompletely processed DNA lesions arising during S or G2 phase, and can result in cytokinesis failure. Also required for homology-directed repair (HDR) of DNA double-strand breaks, in conjunction with SLX4.; Not functional in the nucleotide excision repair pathway.; Not functional in the nucleotide excision repair pathway.; Not functional in the nucleotide excision repair pathway.
Gene References into Functions
  1. Lactacystin enhances cisplatin sensitivity in resistant human ovarian cancer cell lines via inhibition of DNA repair and ERCC-1 expression. PMID: 11936875
  2. Inter-individual variation, seasonal variation and close correlation of OGG1 and ERCC1 mRNA levels in full blood PMID: 12189194
  3. ERCC1-transfected HCT-116 cells showed paradoxical behaviour in vivo with increased growth in mice treated with oxaliplatin as compared to untreated mice. PMID: 30048976
  4. Patients with advanced non-small cell lung cancer (NSCLC) displaying low expression of excision repair cross-complementation group 1 (ERCC1) benefit from cisplatin-based chemotherapy. High expression of ERCC1 indicates better progression-free survival in the treatment with erlotinib/bevacizumab supporting the prognostic impact. PMID: 29905882
  5. Five of these SNPs acted as cis-eQTLs, being associated with the transcription of IREB2 (rs2568494, rs16969968, rs11634351, rs6495309), PSMA4 (rs6495309) and ERCC1 (rs735482), out of 10,821 genes analyzed in lung. For these three genes, we obtained experimental evidence of differential allelic expression in lung tissue, pointing to the existence of in-cis genomic variants that regulate their transcription. PMID: 28181565
  6. We found that patients with positive ERCC1 expression and deficient (d)MMR status had higher overall survival (OS) than those with either positive ERCC1 and pMMR, negative ERCC1 and dMMR, or negative ERCC1 expression and pMMR status (OS 79 vs. 69 vs. 66 vs. 61%, hazard ratio (HR) 0.90, 95% confidence interval (CI) 0.80-1.00; p = 0.043). PMID: 29065415
  7. Gene expression study along with DNA sequence analysis show that different splicing isoforms of ERCC1 affect the expression of its overlapping genes CD3EAP and PPP1R13L. PMID: 29620255
  8. common genetic variations in ERCC1/XPF genes predispose to neuroblastoma risk, which needs to be further validated by ongoing efforts. PMID: 29544698
  9. ERCC1 rs3212986 CC genotype showed a protective effect against radiotherapy-induced acute reactions. PMID: 29631685
  10. Our results indicated a link between ERCC1 rs3212986 and the onset of late gastrointestinal toxicity ..No association was found regarding the XRCC3 rs861539 polymorphism and any clinical toxicity event PMID: 28708208
  11. ERCC1 overexpression is an important phenotype that is associated with esophageal squamous cell carcinoma (ESCC) lymph node metastasis and advanced tumor clinical stages. ERCC1 expression may also inhibit ESCC cell apoptosis via regulating survivin expression, and ERCC1 and survivin overexpression are independent predictors of prognosis for ESCC patients who receive chemotherapy and/or radiotherapy. PMID: 30075571
  12. ERCC1 expression might be a useful predictive marker in patients with locoregionally advanced nasopharyngeal carcinoma receiving cisplatin-based concurrent chemoradiotherapy PMID: 29439312
  13. the present results indicate that the EGFR mutation status and TS and ERCC1 expression can be used as the predictors of overall survival after subsequent second-line treatments for adenocarcinoma non-small-cell lung cancer PMID: 29200955
  14. In conclusion, these findings identified no association between rs11615 and rs2276466 polymorphisms and Colorectal Cancer(CRC) susceptibility, but the data indicate that ERCC1 rs3212986 and rs2298881 polymorphisms may increase susceptibility to CRC. PMID: 29199611
  15. The polymorphisms of rs3212986 showed no association with the risk of preeclampsia in the Chinese Han population. However, the difference in the genotypic distribution between early-onset and late-onset preeclampsia suggest the need for future studies. PMID: 29153678
  16. ERCC1 expression was not prognostic in surgically resected oropharynx/oral cavity squamous cell carcinoma of head and neck PMID: 28645807
  17. A functional relationship of ERCC1 expression with genomic instability in prostate cancer. PMID: 28747165
  18. in nasopharyngeal carcinoma patients, ERCC1 and BRCA1 may be a predictor of response to platinum-based chemotherapy and concurrent radiochemotherapy. PMID: 28404895
  19. Relevant SNPs in DNA repair (ERCC1 and ERCC5) and apoptosis (MDM2 and TP53) genes might influence the severity of radiation-related side-effects in HNSCC patients. Prospective clinical SNP-based validation studies are needed on these bases PMID: 28351583
  20. these studies found that carriers of the T allele of ERCC1 rs11615, XPC rs2228000 and rs50872, particularly in postmenopausal females, have an increased risk of breast cancer PMID: 27768589
  21. Pretreatment ERCC1 expression status predicts tumor response and survival of patients with recurrent or metastatic uterine cervical cancer receiving platinum-based chemotherapy. PMID: 29390553
  22. ERCC1 might be an effective predictor of response to FOLFIRINOX in metastatic pancreatic cancer PMID: 27147577
  23. Both blood and tumor tissue MGMT and ERCC1 methylation were associated with cancer rectum. PMID: 29080834
  24. Data suggest that genetic variants of XRCC4 and ERCC1 may independently or jointly affect survival in chemotherapy-treated gastric cancer (GCa) patients by modulating the gene expression in the tumors. PMID: 28796378
  25. Allelic variants in ERCC1 and ERCC2 are not associated with an increased risk of developing pre-senile cataract. The presence of Gln/Gln in XRCC1 in the pre-senile cataract group with regard to the group without cataract is associated with a major risk of developing pre-senile cataract. PMID: 27668351
  26. ERCC1 polymorphism is associated with colorectal cancer. PMID: 29153096
  27. We demonstrated an association between six previously published single nucleotide polymorphisms (rs15869 [ BRCA2], rs1805389 [ LIG4], rs8079544 [ TP53], rs25489 [ XRCC1], rs1673041 [ POLD1], and rs11615 [ ERCC1]) and subsequent CNS tumors in survivors of childhood cancer treated by radiation therapy. PMID: 28976792
  28. Genetic polymorphism in ERCC1 gene is associated with response to chemotherapy in osteosarcoma. PMID: 28388903
  29. ERCC1 was not detectable in the nucleus of the XPF knockout cells indicating the necessity of a functional XPF/ERCC1 heterodimer to allow ERCC1 to enter the nucleus. PMID: 28130555
  30. There is no association between the ERCC1 C19007T polymorphism and platinum-based chemotherapy effectiveness in ovarian cancer. The polymorphism did not have a significant impact on platinum-based chemotherapy in non-responders and responders. PMID: 28623887
  31. The T allele at ERCC1 rs11615 may interact with smoking and alcohol drinking status to determine personal susceptibility to colorectal cancer. PMID: 28476796
  32. Strikingly, the addition of the single-stranded DNA (ssDNA)-binding replication protein A (RPA) selectively restores XPF-ERCC1 endonuclease activity on this structure. The 5'-3' exonuclease SNM1A can load from the XPF-ERCC1-RPA-induced incisions and digest past the crosslink to quantitatively complete the unhooking reaction. PMID: 28607004
  33. ERCC1 mutation along with BRCA1 mutation confers chemoresistance in breast cancer. PMID: 28124401
  34. The authors have discovered a major sub-pathway of conventional long-patch base excision repair that involves formation of a 9-nucleotide gap 5' to the lesion. This new sub-pathway is mediated by RECQ1 DNA helicase and ERCC1-XPF endonuclease in cooperation with PARP1 poly(ADP-ribose) polymerase and RPA. PMID: 28373211
  35. Based on structural models, NMR titrations, DNA-binding studies, site-directed mutagenesis, charge distribution, and sequence conservation, we propose that the HhH domain of ERCC1 binds to dsDNA upstream of the damage, and XPF binds to the non-damaged strand within a repair bubble PMID: 28028171
  36. Meta-analysis indicated that the ERCC1 rs3212986 polymorphism and 2 polymorphisms in ERCC2 gene (rs13181 and rs1799793) contributed to the susceptibility of glioma. PMID: 28514298
  37. ERCC1-SNP in combination with mRNA ERCC1, DPYD, and ERBB2 from pretherapeutic endoscopic biopsies can predict minor response to chemoradiation, as a basis for individualized therapy of advanced esophageal cancer. PMID: 27741011
  38. Reduced excision repair cross-complementation group 1 (ERCC1) and group 2 (ERCC2) RNA expressions were detected in 50 (78.1%) and 48 (75%) cases, respectively whereas reduced proteins were detected in 48 cases (75%) for ERCC1 and ERCC2. PMID: 28088319
  39. ERCC1 expression was identified as a prognostic marker for overall survival in the patient cohort with operable lesions. Taken together, our data identify ERCC1 as a disease marker in lung adenoma patients from Xuanwei and confirm the significance of resection for the subsequent effect of platinum treatment in these patients PMID: 28260069
  40. ERCC1 is expressed in a significant proportion of upper tract urothelial carcinoma and is linked with tumor necrosis, but its expression appears not to be associated with prognosis following radical nephroureterectomy. PMID: 26658888
  41. RRM1 and ERCC1 expression levels did not show any relationship with overall survival. PMID: 26612755
  42. ERCC1 and BRCA1 were overexpressed in A549/DDP compared with A549 (P<0.05). ERCC1 and BRCA1siRNA transfection can significantly reduce ERCC1 and BRCA1 mRNA and protein expression (P<0.05). Downregulating ERCC1 and BRCA1 expression obviously inhibited cell proliferation and increased caspase 3 activity (P<0.05). Downregulating ERCC1 and BRCA1 significantly decreased PI3K and AKT phosphorylation levels (P<0.05). PMID: 27289442
  43. RRM1 and ERCC wild type alleles are risk-reducing factor for Coronary artery disease (CAD). Also, carrying RRM1 A allele might have a protective effect for smokers. PMID: 27566080
  44. The genetic polymorphisms of ERCC1-8092 are associated with the risk of hepatocellular carcinoma in Guangxi Zhuang population of China PMID: 27858866
  45. Immunohistochemical expression of ERCC1 and XRCC1 has some predictive and prognostic values in patients with biliary tract cancer. Nuclear expression of ERCC1 and XRCC1 may be used to predict therapeutic response in patients undergoing gemcitabine monotherapy. PMID: 26763622
  46. ERCC1 rs3212986 gene polymorphism has a significant effect on the pharmacokinetics and treatment outcome of gastric cancer. No association was found between ERCC1 rs11615 and overall survival of gastric cancer. PMID: 27173253
  47. study finds that ERCC1 and RRM1 are not independent prognostic factors of recurrence in stage I non-small cell lung cancer patients PMID: 26542178
  48. High ERCC1 expression is associated with poor Response to Platinum-Based Induction Chemotherapy in Head and Neck Cancer. PMID: 27165214
  49. ERCC1 rs11615 (C>T) polymorphism was associated with therapeutic response in Caucasian patients and C allele of ERCC1 rs11615 could represent a genetic molecular marker to predict better patient response to radiochemotherapy (meta-analysis). PMID: 27100737
  50. Our results indicated that the ERCC1 codon 118 polymorphism may have predictive potential for chemotherapy treatment responses in late-stage bladder cancer patients PMID: 27323074

Show More

Hide All

Involvement in disease
Cerebro-oculo-facio-skeletal syndrome 4 (COFS4)
Subcellular Location
[Isoform 1]: Nucleus.; [Isoform 2]: Cytoplasm. Nucleus.; [Isoform 3]: Nucleus.; [Isoform 4]: Nucleus.
Protein Families
ERCC1/RAD10/SWI10 family
Database Links

HGNC: 3433

OMIM: 126380

KEGG: hsa:2067

STRING: 9606.ENSP00000013807

UniGene: Hs.435981

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*