Recombinant Human Delta-like protein 3 (DLL3), partial (Active)

In Stock
Code CSB-MP882142HU3d7
Abbreviation Recombinant Human DLL3 protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 2 μg/ml can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 1.107-1.282 ng/mL. Biological Activity Assay
  • The purity of DLL3 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 2 μg/mL can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 1.107-1.282 ng/mL.
Target Names
Uniprot No.
Alternative Names
Delta-like protein 3; Drosophila Delta homolog 3 (Delta3)
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
391-492aa
Target Protein Sequence
DLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Mol. Weight
11.7 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human DLL3 protein is an active protein generated in mammalian cells. Its expression region corresponds to the 391-492aa of the human DLL3. The target gene is co-expressed with the C-terminal 10xHis-tag gene through a plasmid. The resulting DLL3 protein's purity is over 95% as measured by SDS-PAGE. In a functional ELISA, this human DLL3 protein can bind to the DLL3 recombinant antibody (CSB-RA882142MA2HU), with the EC50 of 1.107-1.282 ng/mL.

DLL3 is a Notch ligand that plays a crucial role in various cellular processes, particularly in the development and progression of certain types of cancer [1-6]. DLL3 is primarily localized in the Golgi apparatus and is rarely expressed on the cell surface [7][8]. Unlike other Notch ligands, DLL3 does not activate Notch receptors on neighboring cells. Instead, it can suppress the Notch signaling in a cell-autonomous manner by targeting newly synthesized Notch1 or DLL1 for endosomal/lysosomal degradation [8][9].

DLL3 is highly expressed in various types of cancer, particularly in small cell lung cancer (SCLC), neuroendocrine tumors, and some other neuroendocrine-like cancers [1-6]. High DLL3 expression is often associated with tumor growth, invasion, and metastasis, as well as poor patient prognosis [1][3][5][6]. DLL3 has been shown to regulate the conversion between mesenchymal and epithelial states, which is a crucial process in cancer metastasis [1].

DLL3 may interact with immune-related proteins, such as LG3BP and HSPA8, which regulate immune response [9]. However, the exact mechanisms by which DLL3 modulates the immune system are not yet fully understood. Due to its specific expression in certain types of cancer, DLL3 has emerged as a promising therapeutic target. Several DLL3-targeted therapies, including antibody-drug conjugates, bispecific T-cell engagers, and chimeric antigen receptor T cells, are currently under development and investigation for the treatment of DLL3-positive cancers [2][6][10][11].

References:
[1] C. Zhu. The predictive value of delta-like3 and serum nse in evaluating chemotherapy response and prognosis in patients with advanced small cell lung carcinoma: an observational study, Medicine, vol. 103, no. 23, p. e38487, 2024. https://doi.org/10.1097/md.0000000000038487
[2] L. Saunders, A. Bankovich, W. Anderson, M. Aujay, S. Bheddah, K. Black, et al. A dll3-targeted antibody-drug conjugate eradicates high-grade pulmonary neuroendocrine tumor-initiating cells in vivo, Science Translational Medicine, vol. 7, no. 302, 2015. https://doi.org/10.1126/scitranslmed.aac9459
[3] L. Yang, G. Wang, H. Shi, S. Jia, J. Ruan, R. Cui, et al. Methylation-driven gene dll3 is a potential prognostic biomarker in ocular melanoma correlating with metastasis, Frontiers in Oncology, vol. 12, 2022. https://doi.org/10.3389/fonc.2022.964902
[4] M. Furuta, J. Sakakibara‐Konishi, H. Kikuchi, H. Yokouchi, H. Nishihara, H. Minemura, et al. Analysis of dll3 and ascl1 in surgically resected small cell lung cancer (hot1702), The Oncologist, vol. 24, no. 11, p. e1172-e1179, 2019. https://doi.org/10.1634/theoncologist.2018-0676
[5] M. Furuta, H. Kikuchi, T. Shoji, Y. Takashima, E. Kikuchi, J. Kikuchi, et al. dll3 regulates the migration and invasion of small cell lung cancer by modulating snail, Cancer Science, vol. 110, no. 5, p. 1599-1608, 2019. https://doi.org/10.1111/cas.13997
[6] V. Koshkin, J. García, J. Reynolds, P. Elson, C. Magi‐Galluzzi, J. McKenney, et al. Transcriptomic and protein analysis of small-cell bladder cancer (scbc) identifies prognostic biomarkers and dll3 as a relevant therapeutic target, Clinical Cancer Research, vol. 25, no. 1, p. 210-221, 2019. https://doi.org/10.1158/1078-0432.ccr-18-1278
[7] H. Hamamoto, K. Maemura, K. Matsuo, K. Taniguchi, Y. Tanaka, S. Futaki, et al. Delta-like 3 is silenced by hbx via histone acetylation in hbv-associated hccs, Scientific Reports, vol. 8, no. 1, 2018. https://doi.org/10.1038/s41598-018-23318-1
[8] Y. Mizuno, K. Maemura, Y. Tanaka, A. Hirata, S. Futaki, H. Hamamoto, et al. Expression of delta-like 3 is downregulated by aberrant dna methylation and histone modification in hepatocellular carcinoma, Oncology Reports, 2018. https://doi.org/10.3892/or.2018.6293
[9] J. Ye, J. Wen, D. Wu, B. Hu, M. Luo, Y. Lin, et al. Elevated dll3 in stomach cancer by tumor-associated macrophages enhances cancer-cell proliferation and cytokine secretion of macrophages, Gastroenterology Report, vol. 10, 2021. https://doi.org/10.1093/gastro/goab052
[10] K. Krytska, C. Casey, J. Pogoriler, D. Martı́nez, K. Rathi, A. Farrel, et al. Evaluation of the dll3-targeting antibody–drug conjugate rovalpituzumab tesirine in preclinical models of neuroblastoma, Cancer Research Communications, vol. 2, no. 7, p. 616-623, 2022. https://doi.org/10.1158/2767-9764.crc-22-0137
[11] B. Rath, A. Plangger, D. Krenbek, M. Hochmair, S. Stickler, V. Tretter, et al. Rovalpituzumab tesirine resistance: analysis of a corresponding small cell lung cancer and circulating tumor cell line pair, Anti-Cancer Drugs, vol. 33, no. 3, p. 300-307, 2021. https://doi.org/10.1097/cad.0000000000001267

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm.
Gene References into Functions
  1. these results reveal that DLL3 is expressed in tumor specimens from most patients with small cell lung cancer PMID: 29290251
  2. Results indicated that DLL3 expression was silenced in hepatocellular carcinoma (HCC) cells by DNA methylation and was more readily affected by histone acetylation than histone methylation (H3K9me2 or H3K27me3). PMID: 29512761
  3. our results indicated epidermal growth factor-like domain multiple 7 protein participates in growth hormone-secreting pituitary adenoma proliferation and invasion regulation via Notch2/DLL3 signaling pathway. These findings raised the possibility that epidermal growth factor-like domain multiple 7 protein might serve as a useful biomarker to assess growth hormone-secreting pituitary adenoma invasion and prognosis PMID: 28705113
  4. The Dll3 was rarely detectable in the para-carcinoma tissues, but positive in 82.1% of non-small cell cancer tissues. PMID: 28007595
  5. Both global haplotype and individual haplotype analyses showed that the haplotypes of SNP1/SNP2/SNP3/SNP4/SNP5 did not correlate with the disease (P >0.05). Together, these data suggest that genetic variants of the DLL3 gene are not associated with CS in the Chinese Han population. PMID: 27472720
  6. DLL3 was silenced by methylation in human human hepatocellular carcinoma and it negatively regulates the growth of human hepatocellular carcinoma cells. PMID: 23337976
  7. We suggest that the three human DLL3 mutations associated with spondylocostal dysplasia are also functionally equivalent to the Dll3(neo) null allele in mice. PMID: 11923214
  8. mutations in DLL3 cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis PMID: 12746394
  9. no novel or previously described mutations are present in our cohort, indicating that DLL3 mutations may not be a major cause of congenital scoliosis. PMID: 15717203
  10. The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity PMID: 18676613

Show More

Hide All

Involvement in disease
Spondylocostal dysostosis 1, autosomal recessive (SCDO1)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

HGNC: 2909

OMIM: 277300

KEGG: hsa:10683

STRING: 9606.ENSP00000205143

UniGene: Hs.127792

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*