Product Details

Purity

≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 2 μg/mL can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 1.107-1.282 ng/mL.

Target Names

DLL3

Uniprot No.

Q9NYJ7

Alternative Names

Delta-like protein 3; Drosophila Delta homolog 3 (Delta3)

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

391-492aa

Target Protein Sequence

DLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL

Mol. Weight

11.7 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Delta-like protein 3 functions as a non-canonical Notch ligand that inhibits rather than activates Notch signaling, making it a critical regulator of somitogenesis and a therapeutic target in neuroendocrine cancers. This mammalian-expressed construct spanning residues 391–492 captures a functionally validated extracellular domain fragment, as demonstrated by its binding to an anti-DLL3 recombinant antibody with an EC50 of 1.107–1.282 ng/mL in functional ELISA, confirming conformational integrity suitable for antibody epitope mapping, therapeutic antibody validation, and competitive inhibition screening. The mammalian expression system supports native post-translational modifications and proper disulfide bond formation, features that align with standards expected in surface plasmon resonance and biolayer interferometry assays for affinity characterization of DLL3-targeting biologics. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for drug discovery campaigns focused on antibody-drug conjugates and small-molecule inhibitor development in oncology research.

Target Background

Function

Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm.

Gene References into Functions

these results reveal that DLL3 is expressed in tumor specimens from most patients with small cell lung cancer PMID: 29290251
Results indicated that DLL3 expression was silenced in hepatocellular carcinoma (HCC) cells by DNA methylation and was more readily affected by histone acetylation than histone methylation (H3K9me2 or H3K27me3). PMID: 29512761
our results indicated epidermal growth factor-like domain multiple 7 protein participates in growth hormone-secreting pituitary adenoma proliferation and invasion regulation via Notch2/DLL3 signaling pathway. These findings raised the possibility that epidermal growth factor-like domain multiple 7 protein might serve as a useful biomarker to assess growth hormone-secreting pituitary adenoma invasion and prognosis PMID: 28705113
The Dll3 was rarely detectable in the para-carcinoma tissues, but positive in 82.1% of non-small cell cancer tissues. PMID: 28007595
Both global haplotype and individual haplotype analyses showed that the haplotypes of SNP1/SNP2/SNP3/SNP4/SNP5 did not correlate with the disease (P >0.05). Together, these data suggest that genetic variants of the DLL3 gene are not associated with CS in the Chinese Han population. PMID: 27472720
DLL3 was silenced by methylation in human human hepatocellular carcinoma and it negatively regulates the growth of human hepatocellular carcinoma cells. PMID: 23337976
We suggest that the three human DLL3 mutations associated with spondylocostal dysplasia are also functionally equivalent to the Dll3(neo) null allele in mice. PMID: 11923214
mutations in DLL3 cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis PMID: 12746394
no novel or previously described mutations are present in our cohort, indicating that DLL3 mutations may not be a major cause of congenital scoliosis. PMID: 15717203
The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity PMID: 18676613

Hide All

Involvement in disease

Spondylocostal dysostosis 1, autosomal recessive (SCDO1)

Subcellular Location

Membrane; Single-pass type I membrane protein.

Database Links

HGNC: 2909

OMIM: 277300

KEGG: hsa:10683

STRING: 9606.ENSP00000205143

UniGene: Hs.127792

Code	CSB-MP882142HU3d7
Abbreviation	Recombinant Human DLL3 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$138
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 2 μg/ml can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC₅₀ is 1.107-1.282 ng/mL. Biological Activity Assay The purity of DLL3 was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Delta-like protein 3 (DLL3), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage