Code | CSB-MP882142HU |
Size | $428 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
CUSABIO's product CSB-MP882142HU is an active protein expressed in mammalian cells. Its gene expression region encodes amino acids 27-492 of the human Delta-like protein 3 (DLL3). It is fused with 6xHis-tag at the C-terminus. According to SDS-PAGE, the purity of this protein is greater than 71.6%. It migrated to the molecular weight band of about 55 kDa. Its endotoxin is less than 1.0 EU/ug measured by the LAL method. In the functional ELISA, it can bind to the anti-DLL3 antibody, and the EC50 is 1.102-1.707 ng/mL. DLL3 is a ligand of Notch signaling, which mediates cell‐fate decisions and is tumor‐inhibitory or oncogenic depending on the cellular context. It is highly upregulated and abnormally expressed on the cell surface in small cell lung cancer (SCLC). |
Purity | Greater than 71.6% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized DLL3 at 2 μg/mL can bind Anti-DLL3 Recombinant Antibody(CSB-RA882142A1HU), the EC50 is 1.102-1.707 ng/mL. |
Target Names | DLL3 |
Uniprot No. | Q9NYJ7 |
Research Area | Cell Biology |
Alternative Names | (Drosophila Delta homolog 3)(Delta3) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 27-492aa |
Target Protein Sequence | AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL |
Mol. Weight | 51.5 kDa |
Protein Length | Partial |
Tag Info |
C-terminal 6xHis-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm.
|
Gene References into Functions |
|
Involvement in disease | Spondylocostal dysostosis 1, autosomal recessive (SCDO1) |
Subcellular Location | Membrane; Single-pass type I membrane protein. |
Database Links |
HGNC: 2909 OMIM: 277300 KEGG: hsa:10683 STRING: 9606.ENSP00000205143 UniGene: Hs.127792 |