Recombinant Human Delta-like protein 3 (DLL3), partial (Active)

In Stock Promotion
Code CSB-MP882142HU2d7
Abbreviation Recombinant Human DLL3 protein, partial (Active)
MSDS
Size $138
Order now
Promotion
20% OFF Promotion on CUSABIO Premium Active Proteins
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 2 μg/ml can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 3.990-4.723 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 2 μg/mL can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 3.990-4.723 ng/mL.
Target Names
Uniprot No.
Alternative Names
Delta-like protein 3; Drosophila Delta homolog 3 (Delta3)
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
429-492aa
Target Protein Sequence
RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Mol. Weight
8.1kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human DLL3 protein is an active protein produced in mammalian cells. Its production involves the expression of a plasmid containing the target gene that codes for the 429-492aa of the human DLL3. The target gene is fused with a C-terminal 10xHis-tag gene. The purity of the resulting recombinant DLL3 protein is greater than 95% as determined by SDS-PAGE. The biological activity of this DLL3 protein is validated through ELISA, in which it binds to the DLL3 recombinant antibody (CSB-RA882142MA2HU), with the EC50 of 3.990-4.723 ng/mL.

DLL3 is an inhibitory ligand of the Notch receptor pathway [1][2]. It is predominantly localized in the Golgi apparatus and can activate the Notch signaling in trans [3]. Instead, DLL3 can inhibit Notch receptor activation in cis [2].

DLL3 is expressed during brain development where it regulates somitogenesis [2]. In normal tissues, DLL3 has minimal to no surface expression but is abnormally expressed on the surface in 85-94% of small cell lung cancer (SCLC) cases, making it a potential tumor-selective target for SCLC treatment [4]. DLL3 is also expressed in other types of cancer, such as neuroendocrine prostate cancer and Merkel cell carcinoma [1][2]. In these cancers, DLL3 expression is associated with tumor growth and progression.

The regulation of DLL3 expression is complex and involves various signaling pathways. For example, the transcription factor ASCL1 regulates the expression of DLL3 and other Notch signaling proteins in neuroendocrine tumors [2]. Additionally, DLL3 expression can be modulated by the Notch signaling pathway, as DLL3 is a downstream target of Notch activation [5].

References:
[1] H. Xie, F. Kaye, K. Isse, Y. Sun, J. Ramoth, D. French, et al. Delta-like protein 3 expression and targeting in merkel cell carcinoma, The Oncologist, vol. 25, no. 9, p. 810-817, 2020. https://doi.org/10.1634/theoncologist.2019-0877
[2] L. Puca, K. Gavyert, V. Sailer, V. Conteduca, É. Dardenne, M. Sigouros, et al. Delta-like protein 3 expression and therapeutic targeting in neuroendocrine prostate cancer, Science Translational Medicine, vol. 11, no. 484, 2019. https://doi.org/10.1126/scitranslmed.aav0891
[3] L. Saunders, A. Bankovich, W. Anderson, M. Aujay, S. Bheddah, K. Black, et al. A dll3-targeted antibody-drug conjugate eradicates high-grade pulmonary neuroendocrine tumor-initiating cells in vivo, Science Translational Medicine, vol. 7, no. 302, 2015. https://doi.org/10.1126/scitranslmed.aac9459
[4] X. Nie. Delta‐like ligand 3: a promising target against small cell lung cancer, Aging Medicine, vol. 7, no. 3, p. 283-286, 2024. https://doi.org/10.1002/agm2.12311
[5] D. Jia, J. Underwood, Q. Xu, & Q. Xie. Notch2/notch3/dll3/maml1/adam17 signaling network is associated with ovarian cancer, Oncology Letters, 2019. https://doi.org/10.3892/ol.2019.10170

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm.
Gene References into Functions
  1. these results reveal that DLL3 is expressed in tumor specimens from most patients with small cell lung cancer PMID: 29290251
  2. Results indicated that DLL3 expression was silenced in hepatocellular carcinoma (HCC) cells by DNA methylation and was more readily affected by histone acetylation than histone methylation (H3K9me2 or H3K27me3). PMID: 29512761
  3. our results indicated epidermal growth factor-like domain multiple 7 protein participates in growth hormone-secreting pituitary adenoma proliferation and invasion regulation via Notch2/DLL3 signaling pathway. These findings raised the possibility that epidermal growth factor-like domain multiple 7 protein might serve as a useful biomarker to assess growth hormone-secreting pituitary adenoma invasion and prognosis PMID: 28705113
  4. The Dll3 was rarely detectable in the para-carcinoma tissues, but positive in 82.1% of non-small cell cancer tissues. PMID: 28007595
  5. Both global haplotype and individual haplotype analyses showed that the haplotypes of SNP1/SNP2/SNP3/SNP4/SNP5 did not correlate with the disease (P >0.05). Together, these data suggest that genetic variants of the DLL3 gene are not associated with CS in the Chinese Han population. PMID: 27472720
  6. DLL3 was silenced by methylation in human human hepatocellular carcinoma and it negatively regulates the growth of human hepatocellular carcinoma cells. PMID: 23337976
  7. We suggest that the three human DLL3 mutations associated with spondylocostal dysplasia are also functionally equivalent to the Dll3(neo) null allele in mice. PMID: 11923214
  8. mutations in DLL3 cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis PMID: 12746394
  9. no novel or previously described mutations are present in our cohort, indicating that DLL3 mutations may not be a major cause of congenital scoliosis. PMID: 15717203
  10. The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity PMID: 18676613

Show More

Hide All

Involvement in disease
Spondylocostal dysostosis 1, autosomal recessive (SCDO1)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

HGNC: 2909

OMIM: 277300

KEGG: hsa:10683

STRING: 9606.ENSP00000205143

UniGene: Hs.127792

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*