Recombinant Human Delta-like protein 3 (DLL3), partial (Active)

In Stock
Code CSB-MP882142HU3
Abbreviation Recombinant Human DLL3 protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 1 μg/ml can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 6.080-7.240 ng/mL. Biological Activity Assay
  • The purity of DLL3 was greater than 90% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 1 μg/mL can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 6.080-7.240 ng/mL.
Target Names
Uniprot No.
Alternative Names
Delta-like protein 3; Drosophila Delta homolog 3 (Delta3)
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
391-492aa
Target Protein Sequence
DLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Mol. Weight
39.7 kDa
Protein Length
Partial
Tag Info
C-terminal mFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The gene fragment encoding the 391-492aa of the human DLL3 is co-expressed with the C-terminal mFc-tag gene in mammalian cells. The resulting product is the recombinant human DLL3 protein. This DLL3 protein is active as it can bind to the DLL3 recombinant antibody (CSB-RA882142MA2HU), with the EC50 of 6.080-7.240 ng/mL. Its purity is up to 95% as determined by SDS-PAGE.

The human DLL3 protein is a multifunctional protein that regulates Notch signaling, cell proliferation, migration, and invasion, with particular relevance in the context of neuroendocrine tumors. Its unique expression profile and role in tumor biology make it a potential therapeutic target in certain cancer types.

RDLL3 is an atypical Notch ligand that can inhibit Notch receptor activation [1-3]. This inhibition of Notch signaling promotes neuroendocrine differentiation [2]. DLL3 overexpression has been shown to promote tumor growth and inhibit apoptosis in various cancer types, including small cell lung cancer (SCLC) and hepatocellular carcinoma [4][5]. However, some studies have also reported that DLL3 can induce cellular apoptosis in hepatocellular carcinoma [6]. DLL3 has been found to modulate the epithelial-mesenchymal transition (EMT) process, thereby affecting the migration and invasion of cancer cells, such as in SCLC [5][6]. DLL3 is expressed in the presomitic mesoderm during embryonic development and plays a role in somite patterning and axial skeleton development [11][12].

DLL3 is highly expressed in neuroendocrine tumors, including SCLC, and is a downstream target of the transcription factor ASCL1, which is related to the neuroendocrine phenotype [1][4][7]. Due to its specific expression on the surface of neuroendocrine tumor cells, DLL3 has emerged as a promising target for antibody-drug conjugate (ADC) therapies, particularly in SCLC and other high-grade neuroendocrine tumors [8-10].

References:
[1] D. Morgensztern, B. Besse, L. Greillier, R. Santana-Dávila, N. Ready, C. Hann, et al. Efficacy and safety of rovalpituzumab tesirine in third-line and beyond patients with dll3-expressing, relapsed/refractory small-cell lung cancer: results from the phase ii trinity study, Clinical Cancer Research, vol. 25, no. 23, p. 6958-6966, 2019. https://doi.org/10.1158/1078-0432.ccr-19-1133
[2] S. Tendler, L. Kanter, R. Lewensohn, C. Ortiz-Villalón, K. Viktorsson, & L. Petris. The prognostic implications of notch1, hes1, ascl1, and dll3 protein expression in sclc patients receiving platinum-based chemotherapy, Plos One, vol. 15, no. 10, p. e0240973, 2020. https://doi.org/10.1371/journal.pone.0240973
[3] K. Matsuo, K. Taniguchi, H. Hamamoto, Y. Inomata, K. Komura, T. Tanaka, et al. Delta‐like canonical notch ligand 3 as a potential therapeutic target in malignancies: a brief overview, Cancer Science, vol. 112, no. 8, p. 2984-2992, 2021. https://doi.org/10.1111/cas.15017
[4] C. Zhu. The predictive value of delta-like3 and serum nse in evaluating chemotherapy response and prognosis in patients with advanced small cell lung carcinoma: an observational study, Medicine, vol. 103, no. 23, p. e38487, 2024. https://doi.org/10.1097/md.0000000000038487
[5] M. Furuta, H. Kikuchi, T. Shoji, Y. Takashima, E. Kikuchi, J. Kikuchi, et al. dll3 regulates the migration and invasion of small cell lung cancer by modulating snail, Cancer Science, vol. 110, no. 5, p. 1599-1608, 2019. https://doi.org/10.1111/cas.13997
[6] L. Yang, G. Wang, H. Shi, S. Jia, J. Ruan, R. Cui, et al. Methylation-driven gene dll3 is a potential prognostic biomarker in ocular melanoma correlating with metastasis, Frontiers in Oncology, vol. 12, 2022. https://doi.org/10.3389/fonc.2022.964902
[7] M. Furuta, J. Sakakibara‐Konishi, H. Kikuchi, H. Yokouchi, H. Nishihara, H. Minemura, et al. Analysis of dll3 and ascl1 in surgically resected small cell lung cancer (hot1702), The Oncologist, vol. 24, no. 11, p. e1172-e1179, 2019. https://doi.org/10.1634/theoncologist.2018-0676
[8] K. Krytska, C. Casey, J. Pogoriler, D. Martı́nez, K. Rathi, A. Farrel, et al. Evaluation of the dll3-targeting antibody–drug conjugate rovalpituzumab tesirine in preclinical models of neuroblastoma, Cancer Research Communications, vol. 2, no. 7, p. 616-623, 2022. https://doi.org/10.1158/2767-9764.crc-22-0137
[9] L. Saunders, A. Bankovich, W. Anderson, M. Aujay, S. Bheddah, K. Black, et al. A dll3-targeted antibody-drug conjugate eradicates high-grade pulmonary neuroendocrine tumor-initiating cells in vivo, Science Translational Medicine, vol. 7, no. 302, 2015. https://doi.org/10.1126/scitranslmed.aac9459
[10] L. Brčić, C. Kuchler, S. Eidenhammer, D. Pabst, F. Quehenberger, A. Gazdar, et al. Comparison of four dll3 antibodies performance in high grade neuroendocrine lung tumor samples and cell cultures, Diagnostic Pathology, vol. 14, no. 1, 2019. https://doi.org/10.1186/s13000-019-0827-z
[11] I. Geffers, K. Serth, G. Chapman, R. Jaekel, K. Schuster-Gossler, R. Cordes, et al. Divergent functions and distinct localization of the notch ligands dll1 and dll3 in vivo, The Journal of Cell Biology, vol. 178, no. 3, p. 465-476, 2007. https://doi.org/10.1083/jcb.200702009
[12] P. Turnpenny, N. Whittock, J. Duncan, S. Dunwoodie, K. Kusumi, & S. Ellard. Novel mutations in dll3, a somitogenesis gene encoding a ligand for the notch signalling pathway, cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis, Journal of Medical Genetics, vol. 40, no. 5, p. 333-339, 2003. https://doi.org/10.1136/jmg.40.5.333

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm.
Gene References into Functions
  1. these results reveal that DLL3 is expressed in tumor specimens from most patients with small cell lung cancer PMID: 29290251
  2. Results indicated that DLL3 expression was silenced in hepatocellular carcinoma (HCC) cells by DNA methylation and was more readily affected by histone acetylation than histone methylation (H3K9me2 or H3K27me3). PMID: 29512761
  3. our results indicated epidermal growth factor-like domain multiple 7 protein participates in growth hormone-secreting pituitary adenoma proliferation and invasion regulation via Notch2/DLL3 signaling pathway. These findings raised the possibility that epidermal growth factor-like domain multiple 7 protein might serve as a useful biomarker to assess growth hormone-secreting pituitary adenoma invasion and prognosis PMID: 28705113
  4. The Dll3 was rarely detectable in the para-carcinoma tissues, but positive in 82.1% of non-small cell cancer tissues. PMID: 28007595
  5. Both global haplotype and individual haplotype analyses showed that the haplotypes of SNP1/SNP2/SNP3/SNP4/SNP5 did not correlate with the disease (P >0.05). Together, these data suggest that genetic variants of the DLL3 gene are not associated with CS in the Chinese Han population. PMID: 27472720
  6. DLL3 was silenced by methylation in human human hepatocellular carcinoma and it negatively regulates the growth of human hepatocellular carcinoma cells. PMID: 23337976
  7. We suggest that the three human DLL3 mutations associated with spondylocostal dysplasia are also functionally equivalent to the Dll3(neo) null allele in mice. PMID: 11923214
  8. mutations in DLL3 cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis PMID: 12746394
  9. no novel or previously described mutations are present in our cohort, indicating that DLL3 mutations may not be a major cause of congenital scoliosis. PMID: 15717203
  10. The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity PMID: 18676613

Show More

Hide All

Involvement in disease
Spondylocostal dysostosis 1, autosomal recessive (SCDO1)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

HGNC: 2909

OMIM: 277300

KEGG: hsa:10683

STRING: 9606.ENSP00000205143

UniGene: Hs.127792

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*