Recombinant Human Delta-like protein 3 (DLL3), partial (Active)

In Stock Promotion
Code CSB-MP882142HU2
Abbreviation Recombinant Human DLL3 protein, partial (Active)
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 1 μg/ml can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 6.211-7.209 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 1 μg/mL can bind Anti-DLL3 recombinant antibody (CSB-RA882142MA2HU). The EC50 is 6.211-7.209 ng/mL.
Target Names
Uniprot No.
Alternative Names
Delta-like protein 3; Drosophila Delta homolog 3 (Delta3)
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
429-492aa
Target Protein Sequence
RADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Mol. Weight
36.0kDa
Protein Length
Partial
Tag Info
C-terminal mFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human DLL3 protein is produced by transfecting mammalian cells with a plasmid containing the gene segment encoding the 429-492aa region of the human DLL3. The target gene segment is co-expressed with the C-terminal mFc-tag gene. SDS-PAGE analysis verifies a purity level of this DLL3 protein above 95%. The functional activity of this recombinant DLL3 protein is validated through ELISA, with specific DLL3 recombinant antibody (CSB-RA882142MA2HU) binding showing an EC50 range of 6.211 to 7.209 ng/mL.

Human DLL3 is a member of the Delta/Serrate/LAG-2 (DSL) family of proteins, which play critical roles in the Notch signaling pathway. Unlike other DSL ligands, DLL3 does not activate Notch signaling but instead acts as a negative regulator, inhibiting the signaling induced by other DSL ligands such as DLL1 [1][2]. This unique function positions DLL3 as a significant player in various biological processes, particularly in neurogenesis and the development of certain cancers.

DLL3 is predominantly expressed in neuroendocrine tumors, especially small cell lung cancer (SCLC), where it serves as a potential biomarker and therapeutic target. Studies have shown that DLL3 is highly expressed in SCLC, with approximately 72% of treatment-naïve cases exhibiting positive DLL3 expression [3][4]. Furthermore, DLL3 expression is associated with poor prognosis in various cancers, including endometrial cancer and small cell bladder cancer, where high levels of DLL3 correlate with shorter progression-free survival (PFS) and overall survival (OS) [5][6].

In addition to its role in cancer, DLL3 mutations are implicated in spondylocostal dysostosis (SCD), a genetic disorder characterized by vertebral segmentation defects. Mutations in the DLL3 gene disrupt normal somitogenesis, leading to various skeletal deformities [7-9]. These mutations can result in truncated proteins that fail to function properly, thereby affecting the Notch signaling pathway, which is essential for proper vertebral development [10][11].

References:
[1] E. Ladi, J. Nichols, W. Ge, A. Miyamoto, C. Yao, L. Yang, et al. The divergent dsl ligand dll3 does not activate notch signaling but cell autonomously attenuates signaling induced by other dsl ligands, The Journal of Cell Biology, vol. 170, no. 6, p. 983-992, 2005. https://doi.org/10.1083/jcb.200503113
[2] I. Geffers, K. Serth, G. Chapman, R. Jaekel, K. Schuster-Gossler, R. Cordes, et al. Divergent functions and distinct localization of the notch ligands dll1 and dll3 in vivo, The Journal of Cell Biology, vol. 178, no. 3, p. 465-476, 2007. https://doi.org/10.1083/jcb.200702009
[3] M. Furuta, J. Sakakibara‐Konishi, H. Kikuchi, H. Yokouchi, H. Nishihara, H. Minemura, et al. Analysis of dll3 and ascl1 in surgically resected small cell lung cancer (hot1702), The Oncologist, vol. 24, no. 11, p. e1172-e1179, 2019. https://doi.org/10.1634/theoncologist.2018-0676
[4] D. Morgensztern, B. Besse, L. Greillier, R. Santana-Dávila, N. Ready, C. Hann, et al. Efficacy and safety of rovalpituzumab tesirine in third-line and beyond patients with dll3-expressing, relapsed/refractory small-cell lung cancer: results from the phase ii trinity study, Clinical Cancer Research, vol. 25, no. 23, p. 6958-6966, 2019. https://doi.org/10.1158/1078-0432.ccr-19-1133
[5] J. Wang, K. Zhang, Z. Li, T. Wang, F. Shi, Y. Zhang, et al. Upregulated delta-like protein 3 expression is a diagnostic and prognostic marker in endometrial cancer, Medicine, vol. 97, no. 51, p. e13442, 2018. https://doi.org/10.1097/md.0000000000013442
[6] V. Koshkin, J. García, J. Reynolds, P. Elson, C. Magi‐Galluzzi, J. McKenney, et al. Transcriptomic and protein analysis of small-cell bladder cancer (scbc) identifies prognostic biomarkers and dll3 as a relevant therapeutic target, Clinical Cancer Research, vol. 25, no. 1, p. 210-221, 2019. https://doi.org/10.1158/1078-0432.ccr-18-1278
[7] S. Dunwoodie, M. Clements, D. Sparrow, X. Sa, R. Conlon, & R. Beddington. Axial skeletal defects caused by mutation in the spondylocostal dysplasia/pudgy genedll3are associated with disruption of the segmentation clock within the presomitic mesoderm, Development, vol. 129, no. 7, p. 1795-1806, 2002. https://doi.org/10.1242/dev.129.7.1795
[8] P. Turnpenny, N. Whittock, J. Duncan, S. Dunwoodie, K. Kusumi, & S. Ellard. Novel mutations in dll3, a somitogenesis gene encoding a ligand for the notch signalling pathway, cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis, Journal of Medical Genetics, vol. 40, no. 5, p. 333-339, 2003. https://doi.org/10.1136/jmg.40.5.333
[9] F. Khan, A. Arshad, A. Ullah, E. Steenackers, G. Mortier, F. Ahmad, et al. Identification of a novel nonsense variant in the dll3 gene underlying spondylocostal dysostosis in a consanguineous pakistani family, Molecular Syndromology, vol. 14, no. 3, p. 191-200, 2023. https://doi.org/10.1159/000527043
[10] L. Bonafé, C. Giunta, M. Gassner, B. Steinmann, & A. Superti‐Furga. A cluster of autosomal recessive spondylocostal dysostosis caused by three newly identified dll3 mutations segregating in a small village, Clinical Genetics, vol. 64, no. 1, p. 28-35, 2003. https://doi.org/10.1034/j.1399-0004.2003.00085.x
[11] N. Whittock, S. Ellard, J. Duncan, C. Die-Smulders, J. Vles, & P. Turnpenny. Pseudodominant inheritance of spondylocostal dysostosis type 1 caused by two familial delta‐like 3 mutations, Clinical Genetics, vol. 66, no. 1, p. 67-72, 2004. https://doi.org/10.1111/j.0009-9163.2004.00272.x

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm.
Gene References into Functions
  1. these results reveal that DLL3 is expressed in tumor specimens from most patients with small cell lung cancer PMID: 29290251
  2. Results indicated that DLL3 expression was silenced in hepatocellular carcinoma (HCC) cells by DNA methylation and was more readily affected by histone acetylation than histone methylation (H3K9me2 or H3K27me3). PMID: 29512761
  3. our results indicated epidermal growth factor-like domain multiple 7 protein participates in growth hormone-secreting pituitary adenoma proliferation and invasion regulation via Notch2/DLL3 signaling pathway. These findings raised the possibility that epidermal growth factor-like domain multiple 7 protein might serve as a useful biomarker to assess growth hormone-secreting pituitary adenoma invasion and prognosis PMID: 28705113
  4. The Dll3 was rarely detectable in the para-carcinoma tissues, but positive in 82.1% of non-small cell cancer tissues. PMID: 28007595
  5. Both global haplotype and individual haplotype analyses showed that the haplotypes of SNP1/SNP2/SNP3/SNP4/SNP5 did not correlate with the disease (P >0.05). Together, these data suggest that genetic variants of the DLL3 gene are not associated with CS in the Chinese Han population. PMID: 27472720
  6. DLL3 was silenced by methylation in human human hepatocellular carcinoma and it negatively regulates the growth of human hepatocellular carcinoma cells. PMID: 23337976
  7. We suggest that the three human DLL3 mutations associated with spondylocostal dysplasia are also functionally equivalent to the Dll3(neo) null allele in mice. PMID: 11923214
  8. mutations in DLL3 cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis PMID: 12746394
  9. no novel or previously described mutations are present in our cohort, indicating that DLL3 mutations may not be a major cause of congenital scoliosis. PMID: 15717203
  10. The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity PMID: 18676613

Show More

Hide All

Involvement in disease
Spondylocostal dysostosis 1, autosomal recessive (SCDO1)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

HGNC: 2909

OMIM: 277300

KEGG: hsa:10683

STRING: 9606.ENSP00000205143

UniGene: Hs.127792

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*