Recombinant Human Delta-like protein 3 (DLL3), partial

In Stock
Code CSB-EP882142HU1
Abbreviation Recombinant Human DLL3 protein, partial
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Delta Drosophila like 3; Delta like 3 Drosophila; Delta like 3 homolog Drosophila; Delta like 3 protein; Delta like protein 3 precursor; Delta-like protein 3; Delta3; Dll3; DLL3_HUMAN; Drosophila Delta homolog 3; SCDO1; SCOD1; Spondylocostal dysostosis autosomal recessive
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
383-492aa
Target Protein Sequence
FAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.2 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This is a recombinant fragment of human Delta‑like protein 3 (DLL3), spanning amino acids 383–492, expressed in E.coli with an N‑terminal 6×His‑SUMO tag and purified to >85% by SDS‑PAGE. It has a molecular weight of ~24.2 kDa and is supplied as liquid or lyophilized powder to meet different requirements.


Potential Applications

Note: The following applications are based on the known biological functions of DLL3 protein and scientific literature predictions. Our company has not validated all listed applications, and specific effects need to be verified by customers according to their experimental requirements. We recommend conducting small-scale preliminary experiments before formal studies.

1. Study of the DLL3 C-terminal Functional Domain

Application:
Used to study the specific functions and regulatory roles of the C-terminal region (383–492aa) of DLL3. It can help compare with full-length DLL3 to understand its role in protein stability and function. It is also useful for analyzing truncated mutants and for studying how this region affects the protein’s overall shape and activity.

Scientific Basis:
The C-terminal region of DLL3 contains important regulatory sequences. Its integrity is essential for correct folding and proper function.


2. Development of Domain-Specific Antibodies

Application:
Serves as a specific antigen for developing monoclonal antibodies targeting the C-terminal region of DLL3. It can be used to screen region-specific antibodies, verify binding by ELISA and Western blot, develop C-terminal-based detection methods, and create diagnostic tools that distinguish full-length from truncated DLL3.

Scientific Basis:
Antibodies that recognize the C-terminal region can detect different DLL3 forms and cleavage products. This may help in tumor classification and prognosis.


3. Epitope Mapping for Protein Interactions

Application:
Used to pinpoint interaction sites within the DLL3 C-terminal region. Yeast two-hybrid screening can identify specific binding partners. GST pull-down assays can confirm known interactions. Peptide competition experiments can locate key binding sequences. Truncated mutants can be used to study functional impacts.

Scientific Basis:
C-terminal regions often contain important binding motifs, which are critical for understanding protein interactions and functions.


4. Immunoassay Optimization

Application:
Used to improve the specificity of DLL3 detection methods. It can act as a competing antigen in competitive ELISA, serve as a blocking control in IHC staining, help develop sandwich ELISA based on C-terminal epitopes, or validate cross-reactivity in multiplex immunofluorescence.

Scientific Basis:
Using recombinant protein fragments can increase the specificity and accuracy of immunoassays.


5. Study of Protein Stability and Folding

Application:
Used to explore the folding properties and stability of the DLL3 C-terminal region. Circular dichroism (CD) can reveal its secondary structure. Dynamic light scattering (DLS) can assess aggregation. Thermal stability tests can evaluate its folding robustness. The fragment’s behavior under different conditions can also be studied.

Scientific Basis:
Understanding the folding of individual regions supports structural and functional studies of the full-length protein.


6. Biomarker Development

Application:
Used to develop assays that detect the C-terminal fragment of DLL3 as a specific biomarker. ELISA can be set up to measure this fragment in serum. It can help track DLL3 cleavage products. Tissue-specific staining protocols and peptide chip platforms can also be developed.

Scientific Basis:
Different parts of DLL3 may have distinct biological roles. C-terminal-specific detection could help in disease diagnosis and monitoring.


7. Vaccine Antigen Design

Application:
Used as a potential antigen in DLL3-based cancer immunotherapy. This fragment’s ability to trigger specific immune responses can be tested. Epitope mapping can help design effective peptide vaccines. It can also be combined with other tumor antigens in multivalent vaccine strategies.

Scientific Basis:
Smaller protein fragments may reduce the risk of non-specific immune responses, making them more suitable as vaccine antigens.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm.
Gene References into Functions
  1. these results reveal that DLL3 is expressed in tumor specimens from most patients with small cell lung cancer PMID: 29290251
  2. Results indicated that DLL3 expression was silenced in hepatocellular carcinoma (HCC) cells by DNA methylation and was more readily affected by histone acetylation than histone methylation (H3K9me2 or H3K27me3). PMID: 29512761
  3. our results indicated epidermal growth factor-like domain multiple 7 protein participates in growth hormone-secreting pituitary adenoma proliferation and invasion regulation via Notch2/DLL3 signaling pathway. These findings raised the possibility that epidermal growth factor-like domain multiple 7 protein might serve as a useful biomarker to assess growth hormone-secreting pituitary adenoma invasion and prognosis PMID: 28705113
  4. The Dll3 was rarely detectable in the para-carcinoma tissues, but positive in 82.1% of non-small cell cancer tissues. PMID: 28007595
  5. Both global haplotype and individual haplotype analyses showed that the haplotypes of SNP1/SNP2/SNP3/SNP4/SNP5 did not correlate with the disease (P >0.05). Together, these data suggest that genetic variants of the DLL3 gene are not associated with CS in the Chinese Han population. PMID: 27472720
  6. DLL3 was silenced by methylation in human human hepatocellular carcinoma and it negatively regulates the growth of human hepatocellular carcinoma cells. PMID: 23337976
  7. We suggest that the three human DLL3 mutations associated with spondylocostal dysplasia are also functionally equivalent to the Dll3(neo) null allele in mice. PMID: 11923214
  8. mutations in DLL3 cause a consistent pattern of abnormal vertebral segmentation in spondylocostal dysostosis PMID: 12746394
  9. no novel or previously described mutations are present in our cohort, indicating that DLL3 mutations may not be a major cause of congenital scoliosis. PMID: 15717203
  10. The intracellular region of Notch ligands Dll1 and Dll3 regulates their trafficking and signaling activity PMID: 18676613

Show More

Hide All

Involvement in disease
Spondylocostal dysostosis 1, autosomal recessive (SCDO1)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

HGNC: 2909

OMIM: 277300

KEGG: hsa:10683

STRING: 9606.ENSP00000205143

UniGene: Hs.127792

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*