Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

EDIL3

Uniprot No.

O43854

Research Area

Cardiovascular

Alternative Names

(Developmentally-regulated endothelial cell locus 1 protein)(Integrin-binding protein DEL1)

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

24-480aa

Target Protein Sequence

DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

57.0 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

In expressing the recombinant Human EDIL3 protein, baculovirus cells are transfected with a DNA expression vector that harbors the gene for the desired protein (24-480aa). The cultured cells then express the intended protein. The protein is equipped with a C-terminal 6xHis tag. The recombinant Human EDIL3 protein is collected and purified from the cell lysate through affinity purification, achieving a purity surpassing 85%, as confirmed by SDS-PAGE.

Target Background

Function

Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development.

Gene References into Functions

EDIL3 may be implicated in retinal neovascularization in vitro. Silencing EDIL3 expression was demonstrated to impair the proliferative, migratory and tube forming capabilities of HRECs in vitro. PMID: 28765888
these data reveal an unrecognised function of endogenous Del-1 as a local inhibitor of ischaemia-induced angiogenesis by restraining LFA-1-dependent homing of pro-angiogenic haematopoietic cells to ischaemic tissues PMID: 28447099
Del-1-induced HSC proliferation and myeloid lineage commitment were mediated by beta3 integrin on hematopoietic progenitors. PMID: 28846069
Del-1 pre-treatment of blood before addition of islets diminished coagulation activation and islet damage PMID: 26676803
Del-1 on circulating EVs is a promising marker to improve identification of patients with early-stage breast cancer and distinguish breast cancer from benign breast tumors and noncancerous diseases. PMID: 26603257
Overexpressed EDIL3 promotes anchorage-independent tumor growth in human pancreatic cancer. PMID: 26735172
Overexpression of the Del-1 gene potentiates proliferation and invasion of lung carcinoma cells. PMID: 26545781
The importance of interaction between EDIL3 and integrin alphaV. PMID: 25273699
The reciprocal regulation between Del-1 and inflammation may contribute to optimally balance the protective and the potentially harmful effects of inflammatory cell recruitment. PMID: 24416060
Downregulation of developmentally regulated endothelial cell locus-1 inhibits the growth of colon cancer. PMID: 19292890
Del-1 may act as a gatekeeper of adrenal gland inflammation and may regulate the integrity of the hypothalamic-pituitary-adrenal axis stress response, thereby modulating adrenal (dys)function in the course of SIRS. PMID: 23364949
database search for EGF domain sequences shows that this RGD finger is likely an evolutionary insertion and unique to the EGF domain of Del-1 PMID: 22601780
Del-1 mediates phosphatidylserine- and integrin-dependent endothelial uptake of microparticles by endocytosis. PMID: 22388320
High expression level of EDIL3 predicts poor prognosis of hepatocellular carcinoma patients. PMID: 20857535
Del1 mediates vascular smooth muscle cell adhesion, migration, and proliferation through interaction with integrin alpha(v)beta(3). PMID: 11959660
acts as an angiogenic factor in the context of solid tumor formation; the increase in vascularization accelerates tumor growth through decreased apoptosis PMID: 12074641
Alpha v beta 5, alpha v beta 5 and their ligands Del-1 and L1 play an important role in the process of tumor cells moving from the original place. PMID: 18090124

Hide All

Subcellular Location

Secreted.

Database Links

HGNC: 3173

OMIM: 606018

KEGG: hsa:10085

STRING: 9606.ENSP00000296591

UniGene: Hs.482730

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-BP007399HU
Abbreviation	Recombinant Human EDIL3 protein
MSDS	MSDS Datasheet
Size	$400
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage