Recombinant Human Elafin(PI3)

Code CSB-YP017952HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P19957
Relevance Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP017952HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PI3.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP017952HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PI3.
Storage Buffer Tris-based buffer,50% glycerol
Alias Elastase-specific inhibitor ;ESIPeptidase inhibitor 3 ;PI-3;Protease inhibitor WAP3Skin-derived antileukoproteinase ;SKALPWAP four-disulfide core domain protein 14
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Research Area Signal Transduction
Source Yeast
Gene Names PI3
Protein Names Recommended name: Elafin Alternative name(s): Elastase-specific inhibitor Short name= ESI Peptidase inhibitor 3 Short name= PI-3 Protease inhibitor WAP3 Skin-derived antileukoproteinase Short name= SKALP WAP fo
Expression Region 61-117aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 8.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis.
Subcellular Location Secreted
Database Links

HGNC: 8947

OMIM: 182257

KEGG: hsa:5266

STRING: 9606.ENSP00000243924

UniGene: Hs.112341

Related Products

PI3 Antibodies

PI3 Antibodies for Human

PI3 Antibodies for Homo sapiens (Human)

PI3 Proteins

PI3 Proteins for Homo sapiens (Human)

PI3 ELISA Kit

PI3 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.