Recombinant Human Elafin (PI3)

In Stock
Code CSB-YP017952HU
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP017952HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PI3.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP017952HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PI3.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PI3
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Cementoin; ELAF_HUMAN; Elafin; Elafin/Skalp; Elastase Specific Inhibitor; Elastase-specific inhibitor; ES 1; ESI; Peptidase inhibitor 3; Peptidase inhibitor 3; skin derived; PI 3; PI-3; PI3; Pre elafin; Protease inhibitor 3 skin derived ; Protease inhibitor 3; skin derived (SKALP); Protease inhibitor WAP3; SKALP; Skin derived Anti leukoproteinase; Skin-derived antileukoproteinase; Trappin 2; WAP four disulfide core domain 14; WAP four disulfide core domain protein 14; WAP four-disulfide core domain protein 14; WAP3; WFDC14
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
61-117aa
Target Protein Sequence
AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
8.0kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human PI3 is a yeast-expressed (61-117aa) protein with N-terminal 6xHis tag. The purity is 90%+ measured by SDS-PAGE. The highly developed genetic system, ease of use, reduced time input, and costs have made Pichia Pastoris an attractive organism for the expression and production of recombinant proteins. So we choose the Yeast system to express this recombinant PI3 protein, which is able to carry specifically designed plasmids, and the plasmid used consists of restriction sites that can be used to insert the gene sequence of interest. Transformation of yeasts with the plasmid produces the desired protein and can be appropriately scaled up.

PI3, also called Elafin, is an endogenous serine protease inhibitor that constitutes the epithelial barrier against neutrophil elastase (NE) and protease 3 (PR3). It can reduce airway mucus hypersecretion and decrease inflammatory lung injury. In addition to having protease inhibitory activity, Elafin also exerts several functions such as anti-inflammation, antimicrobe, antiproliferation, immune modulation, vascular remodeling, and wound healing. It is downregulated in several inflammatory diseases, including acute respiratory distress syndrome, inflammatory bowel disease, and acute lung injury. Elafin is differentially expressed in several tumors. Enhanced Elafin expression is associated with the differentiation of esophageal cancer. While downregulation of Elafin is detected in ductal carcinoma in situ, invasion breast cancer, and invasion ovarian cancer.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis. Has been shown to inhibit the alpha-4-beta-2/CHRNA2-CHRNB2 nicotinic acetylcholine receptor and to produce a weak inhibition on Kv11.1/KCNH2/ERG1 and on the transient receptor potential cation channel subfamily V member 1 (TRPV1).
Gene References into Functions
  1. Elafin decreased in active patients with inflammatory bowel disease and was negatively correlated with disease activity, suggesting that elafin may play a protective role PMID: 29084078
  2. Plasma Neutrophil Elastase and Elafin as Prognostic Biomarker for Acute Respiratory Distress Syndrome PMID: 28187039
  3. UV phototoxicity-induced pre-elafin inside keratinocytes prior to cornified envelope formation could be involved in UV-induced keratinocyte apoptosis via cystatin-A downregulation resulting in pro-caspase-3 activation. PMID: 28119996
  4. Recombinant human elafin promotes alveologenesis in newborn mice exposed to chronic hyperoxia PMID: 28802561
  5. significantly higher expression in preterm prelabor ruptured fetal membranes than in membranes from term birth PMID: 27580179
  6. Our study revealed that high elafin levels identified in smoking- and asthma-related microarray data sets and an epidemiologic study significantly reduced the risk of asthma. PMID: 26932165
  7. The expression of elafin in fallopian tubes of ectopic pregnancies is reduced. PMID: 25356943
  8. The elevations in cervical elafin and SLPI expression in the women with preterm delivery might reflect the local response to the pathogen invasion into the cervix preceding preterm labor. PMID: 25559229
  9. PI3 expression was downregulated in 24% of DCIS and 83% of invasive breast tumors. PI3 was also downregulated in 33% of ovarian cystadenomas, 43% of borderline ovarian tumors, and 86% of invasive ovarian carcinomas. PMID: 25551582
  10. The imbalance between neutrophil elastase and its inhibitors, such as elafin, presents an important therapeutic target in breast cancer. PMID: 25195861
  11. Higher urinary elafin levels are associated with an increased risk of micro- and macroalbuminuria, acute kidney injury and chronic kidney disease, and death after hematopoietic stem cell transplantation. PMID: 25388519
  12. cutaneous elafin does not seem to discriminate acute graft-versus-host disease from drug hypersensitivity rash lesions, but there may be an association between cutaneous elafin expression and poor prognosis for patients with cutaneous GVHD PMID: 25405322
  13. Data indicate that elafin overexpression is associated with poor overall survival. PMID: 24469047
  14. Low expression of elafin gene correlated with significantly reduced time to relapse, and when combined with high expression of elastase gene was associated with decreased survival in breast cancer patients PMID: 23320734
  15. Elafin has important roles in normal homoeostasis and at sites of inflammation. These roles include antiprotease and antimicrobial activity. PMID: 19906197
  16. Results confirm the association between SNP rs2664581 and enhanced risk of developing acute respiratory distress syndrome. PMID: 24617927
  17. Tubal epithelium from women with hydrosalpinx has lower levels of elafin expression. PMID: 23885101
  18. Elafin expression in the small intestinal epithelium was lower in patients with active celiac disease compared with control patients. In vitro, elafin significantly slowed the kinetics of the deamidation of the 33-mer peptide to its more immunogenic form. PMID: 24710505
  19. Production of HBD2 and elafin by vaginal epithelial cells is sensitive to E, suggesting that innate immune protection varies in the vagina across the menstrual cycle. PMID: 23398087
  20. Elafin expression may establish the diagnosis of pre-engraftment syndrome and graft versus host disease. PMID: 23866880
  21. Trappin-2 and elafin significantly reduce HSV-2 viral attachment to, and replication in genital epithelial cells. PMID: 23637403
  22. The N-terminus of elafin is critical for intranuclear localization and anti-HIV-1 activity. PMID: 23300756
  23. Studies indicate that Trappin-2/Elafin possessing anti-microbial properties against different classes of pathogens including viruses, fungi and bacteria. PMID: 22634606
  24. The results suggest that decreased expression of elastin and LOX and increased expression of elafin in the cardinal ligaments may contribute to pelvic organ prolapse. PMID: 19087518
  25. The endometrium of women with hydrosalpinx has an increased number of neutrophils and lower expression of elafin, an elastase inhibitor and natural antimicrobial molecule. PMID: 21392745
  26. these results collectively suggest that, in melanoma cells, Foxa2 expression is silenced and therefore elafin is maintained unexpressed to facilitate cell proliferation in the disease melanoma. PMID: 21466784
  27. ability to modulate the expression of some P.aeruginosa virulence factors PMID: 20932308
  28. These results suggest that elafin can maintain airway epithelium integrity by protecting airway epithelial cells and enhancing the anti-inflammatory capability of airway. PMID: 19823954
  29. increased production at the secretory phase of the menstrual cycle relative to the proliferative phase PMID: 19824918
  30. Elafin has a role in graft-versus-host disease of the skin PMID: 20371463
  31. Elafin may serve as a determinant of poor survival in serous ovarian carcinomas PMID: 20126474
  32. Overexpression of elafin in epithelial cells attenuated the damage of Pseudomonas aeruginosa biofilm. PMID: 19420899
  33. Elafin is a component of cervicovaginal secretions in pregnancy, and levels are diminished in bacterial vaginosis. PMID: 19723838
  34. Synthesized locally at mucosal sites. Efficiently inhibit target enzymes released into interstitium. Might be important in controlling excessive neutrophil elastase release in chronic obstructive pulmonary disease and cystic fibrosis. (review) PMID: 11667971
  35. regulation of the elafin gene is dependent on chromatin structure in keratinocytes PMID: 12542536
  36. results indicate that elafin may have a dual function, promoting up-regulation of local lung innate immunity while simultaneously down-regulating potentially unwanted systemic inflammatory responses in the circulation PMID: 12819058
  37. elafin regulates proteolytic enzymes during menstruation and contributes to the innate defense against uterine infection PMID: 12970320
  38. Serine elastase inhibition (elafin overexpression) appears to suppress inflammation, cardiac dilatation, and dysfunction after myocardial infarct. PMID: 14693682
  39. Gene augmentation of human elafin suggests a novel and extended anti-inflammatory role for this human neutrophil elastase inhibitor working as an effector of innate immunity to protect tissues against maladaptive inflammatory responses. PMID: 15034071
  40. The differential biological activity of elafin in different conditions suggests a role for this molecule in either LPS detoxification or activation of innate immune responses, depending on the external cellular environment. PMID: 15668324
  41. Oxidized elafin poorly inhibits the elastolytic activity of leukocyte elastase and proteinase 3. PMID: 16279952
  42. transglutaminase 2-mediated cross-linking of serine protease inhibitors elafin and trappin-2 to neutrophil serine proteinases preserves their inhibitory capacities PMID: 16300411
  43. The pleiotropic molecule elafin has significant potential in modulating antigen-presenting cell numbers and activity, and could be beneficial in mucosal protective strategies. PMID: 16424380
  44. The promoter sequences of PI3 have a high degree of variability. PMID: 16719916
  45. beneficial effects of pre-elafin could be mediated, at least in part, by its ability to increase G-CSF levels in the lung PMID: 16913840
  46. The transglutaminase substrate moiety of elafin plays an important role in anchoring elafin at its proper sites of action during UV-induced aging processes. PMID: 17139263
  47. Levels of mRNA and immunostaining of the antiproteases elafin and SLPI were enhanced strongly in inflamed versus noninflamed UC. Elafin and SLPI may be added to the list of defensin-like peptides with diminished induction in CD versus UC. PMID: 17200145
  48. full antipeptidase activity of pre-elafin is essential to protect against lung tissue lesions PMID: 17489739
  49. This review focuses on recent findings revealing that elafin has many biological functions as diverse as anti-bacterial, anti-fungal, anti-viral, anti-inflammatory and immuno-modulatory functions. PMID: 17964057
  50. We report here that pre-elafin inhibits a secreted peptidase to prevent Pseudomonas aeruginosa growth in vitro. PMID: 18025118

Show More

Hide All

Subcellular Location
Secreted.
Database Links

HGNC: 8947

OMIM: 182257

KEGG: hsa:5266

STRING: 9606.ENSP00000243924

UniGene: Hs.112341

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*