Recombinant Human Endoplasmic reticulum resident protein 29 (ERP29)

Code CSB-YP007800HUa4
Abbreviation Recombinant Human ERP29 protein
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Endoplasmic reticulum resident protein 28;Endoplasmic reticulum resident protein 31
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
33-261aa
Target Protein Sequence
LHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.0 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-sumostar-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
Gene References into Functions
  1. Downregulation of ERp29 was commonly found in GC tissues and highly correlated with more aggressive phenotypes and poorer prognosis. PMID: 28874138
  2. The anti-aggregation peptide ReACp53 significantly decreased ERP29 expression and suppressed the chemoresistant effect. These findings highlight a role of ERP29 in the acquired chemoresistance of cancer cells expressing the aggregating p53 mutant Arg282Trp. PMID: 28534505
  3. Results of further analyses by using a CNX mutant imply that ERp29 and ERp57 recognize the same domain of CNX, whereas the mode of interaction with CNX might be somewhat different between them. PMID: 28456374
  4. High ERP29 expression is associated with pancreatic ductal adenocarcinomas. PMID: 26887611
  5. our studies prove a novel function of ERp29\MGMT in cancer cell survival against radiation. Targeting ERp29\MGMT axis may be useful for providing better treatment efficacy in combination with radiotherapy in breast cancer. PMID: 26420420
  6. Endoplasmic reticulum protein 29 attenuates CSE-induced ER stress and enhances cell viability and barrier integrity of RPE cells, and therefore may act as a protective mechanism for RPE survival and activity. PMID: 26431474
  7. CLIC4, ERp29, and Smac/DIABLO integrated into a novel panel based on cancer stem-like cells in association with metastasis stratify the prognostic risks of colorectal cancer. PMID: 24916695
  8. overexpression of ERp29 may play a key role in apoptosis in HTR-8/SVneo cells via activation of p38, which may participate in the pathogenesis of intrahepatic cholestasis of pregnancy PMID: 24780196
  9. ERp29 directs ENaC toward the Golgi, where it undergoes cleavage during its biogenesis and trafficking to the apical membrane. PMID: 24944201
  10. Apoptosis related proteins ERp29, PRDX6 and MPO were differentially expressed in placentas of pregnant women with intrahepatic cholestasis and in healthy pregnant women. PMID: 24391750
  11. S1P1 overexpression or ERp29 absence is related to the carcinogenesis and progression, and may be potential biomarkers for early detection of gallbladder adenocarcinoma. PMID: 23558074
  12. ERp29 is a novel molecule that regulates MET and epithelial cell integrity in breast cancer cells. PMID: 22543584
  13. Overexpression of ERp29 increases the radioresistance in nasopharyngeal carcinoma. PMID: 21479953
  14. Suggest that ERp29 associates with radioresistance in nasopharyngeal carcinoma and may be potential biomarker for predicting response to radiotherapy. PMID: 22160175
  15. Eurycomanone affects the transcription of Erp28, annexin 1 and prohibitin resulting in reduced expression of these proteins. PMID: 21903368
  16. interplay between p38 phosphorylation and p58(IPK) upregulation has key roles in modulating ERp29-induced cell-growth arrest and survival PMID: 22064321
  17. ERp29 is a 4PBA-regulated ER chaperone that regulates WT-CFTR biogenesis and can promote DeltaF508-CFTR trafficking in CF epithelial cells PMID: 21525008
  18. Results identify ERp29 as a novel regulator of PERK and provide evidence for the role of ER resident factors in the regulation of chemotherapeutic efficacy. PMID: 21419175
  19. High expression of ERp29 inversely correlates to tumor progression. PMID: 20920593
  20. Expression and tissue distribution of ERp29 [review] PMID: 12362325
  21. ERp29 is an unusual redox-inactive member of the thioredoxin family [review] PMID: 16677078
  22. ERP29 is expressed in a subset of basal-cell carcinoma of the skin, with the infiltrating carcinomas exhibiting the highest incidence of immunopositivity. PMID: 17012915
  23. Results found that ERp29 comprises significant alpha-helical structure. PMID: 17073718
  24. mutants of the D-domain of ERp29 prevent transport of a substrate protein (Pipe) in a manner consistent with the presence of a discrete, conserved peptide binding site in the D-domain PMID: 17296603
  25. ERp29-activated polyomavirus perforates the physiologically relevant ER membrane, an event that likely initiates viral penetration. PMID: 17881435
  26. lactating mammary glands were expressing ERp29 while the resting glands did not PMID: 18395818
  27. there are two putative peptide binding sites of ERp29 and different processing activity of the human and Drosophila proteins in vivo does not stem from differences in peptide binding properties. PMID: 19084538
  28. The level of ER protein 29 (ERp29) was shown to be decreased in the CK19-expressing BT549 breast cancer cell line. PMID: 19265690
  29. This supports a new role for ERp29 as a chaperone that helps stabilize monomeric Cx43 to enable oligomerization to occur in the Golgi apparatus. PMID: 19321666
  30. ERp29 is a novel regulator leading to cell growth arrest and cell transition from a proliferative to a quiescent state. PMID: 19770839

Show More

Hide All

Subcellular Location
Endoplasmic reticulum lumen. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Tissue Specificity
Ubiquitous. Mostly expressed in secretory tissues.
Database Links

HGNC: 13799

OMIM: 602287

KEGG: hsa:10961

STRING: 9606.ENSP00000261735

UniGene: Hs.75841

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*