Recombinant Human Eosinophil peroxidase (EPX)

Code CSB-BP007756HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP007756HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP007756HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
EPX
Uniprot No.
Alternative Names
Eosinophil peroxidase [Precursor]; Eosinophil peroxidase; Eosinophil peroxidase heavy chain; EPER; EPO; EPP; EPX; EPX PEN; PERE; PERE_HUMAN
Species
Homo sapiens (Human)
Expression Region
140-715
Target Protein Sequence
R CSDKYRTITG RCNNKRRPLL GASNQALARW LPAEYEDGLS LPFGWTPSRR RNGFLLPLVR AVSNQIVRFP NERLTSDRGR ALMFMQWGQF IDHDLDFSPE SPARVAFTAGVDCERTCAQLPPCFPIKIPPNDPRIKNQRDCIPFFRSAPSCPQNKNRVRNQINALTSFVD ASMVYGSEVSLSLRLRNRTNYLGLLAINQRFQDNGRALLPFDNLHDDPCLLTNRSARIPC FLAGDTRSTETPKLAAMHTLFMREHNRLATELRRLNPRWNGDKLYNEARKIMGAMVQIIT YRDFLPLVLGKARARRTLGHYRGYCSNVDPRVANVFTLAFRFGHTMLQPFMFRLDSQYRA SAPNSHVPLSSAFFASWRIVYEGGIDPILRGLMATPAKLNRQDAMLVDELRDRLFRQVRR IGLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLYGTPD NIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTKRQRKALSRIS LSRIICDNTGITTVSRDIFRANIYPRGFVNCSRIPRLNLSAWRGT
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates tyrosine nitration of secondary granule proteins in mature resting eosinophils. Shows significant inhibitory activity towards Mycobacterium tuberculosis H37Rv by inducing bacterial fragmentation and lysis.
Gene References into Functions
  1. peroxidase enzymes, like MPO and EPO, may play a fundamental role in inhibiting RANKL-induced osteoclast differentiation at inflammatory sites of bone fracture and injury. PMID: 27836774
  2. Both MPO and EPO are causatively involved in breast cancer progression and identified as potential therapeutic targets whereby specific novel inhibitors may reduce tumor growth and limit the occurrence of metastasis. PMID: 28260049
  3. The main significance of this work is the discovery of EPO as a novel ligand for the HER2 receptor. Following HER2 activation, EPO induces activation of FAK and subsequent activation of beta1-integrin, via inside-out signaling. This complex results in downstream activation of ERK1/2 and a sustained up regulation of both MUC4 and the HER2 receptor PMID: 27519953
  4. EPO-mediated protein carbamylation is promoted during allergen-induced asthma exacerbation, and can both modulate immune responses and trigger a cascade of many of the inflammatory signals present in asthma. PMID: 27587397
  5. there is a strong association in a given patient between both nasal and pharyngeal EPX levels and the eosinophil percentage of induced sputum. PMID: 26645423
  6. Myeloperoxidase and eosinophil peroxidase are readily internalized by HUVEC cells where they promote cellular proliferation, migration, invasion, and stimulate angiogenesis both in vitro and in vivo. PMID: 26386352
  7. A preferential role of EPO signaling via a specific surface receptor that leads to neural plasticity. PMID: 24937179
  8. mRNA levels of eosinophil granule proteins, rather than sputum eosinophil%, may reflect airway hyperresponsiveness and airflow limitation. PMID: 24814827
  9. Eosinophil peroxidase in sputum represents a unique biomarker of airway eosinophilia. PMID: 23931643
  10. report the prevalence of a common SNP in the eosinophil protein x/eosinophil-derived neurotoxin (EPX/EDN, RNase2) and the association with the cellular contents of EPX/EDN and ECP PMID: 24738159
  11. Polymorphisms of EPX and ECP are associated to inflammatory bowel disease in an age and gender dependent manne. PMID: 23197886
  12. Data indicate that eosinophil peroxidase (EPX)-based ELISA is the only eosinophil-specific assay. PMID: 22750539
  13. A mechanism of induction of ASIC-3 expression relevant to AR was suggested by the finding that eosinophil peroxidase (EPO), acting via ERK1/2, induced the expression of ASIC-3 in epithelial cells. PMID: 22702502
  14. HER2 was identified as a novel mediator of eosinophil peroxidase signaling. Eosinophil peroxidase, at noncytotoxic levels, can drive cell-cycle progression and proliferation. PMID: 21454806
  15. EPO-dependent oxidative damage may play a role in tissue injury in bisulfite-exacerbated eosinophilic inflammatory disorders PMID: 20501663
  16. induces surface alteration, killing, and lysis of Mycobacterium tuberculosis PMID: 12540536
  17. results suggest that Pro358Leu in EPO is strongly involved in the development of cedar pollinosis PMID: 14657871
  18. Polymorphisms of the eosinophil peroxidase gene may be associated with Japanese cedar pollinosis. PMID: 15316147
  19. Analysis of the role of thiocyanate (SCN-), in modulating the catalytic activity of myeloperoxidase (MPO) and other members of the lactoperoxidase (LPO) and eosinophil peroxidase (EPO) PMID: 15894800
  20. The mechanisms by which eosinophil peroxidase oxidizes nitrite are reported. PMID: 16336215
  21. post-translational tyrosine nitration of eosinophil granule toxins mediated by eosinophil peroxidase PMID: 18694936
  22. No variation in genes eosinophil peroxidase for Atopic dermatitis pathogenesis in this German cohort. PMID: 19014520
  23. Genetic variability in the EPO gene may contribute to the susceptibility to allergic rhinitis (or related phenotypes) in the Czech population. PMID: 19439985

Show More

Hide All

Involvement in disease
Eosinophil peroxidase deficiency (EPXD)
Subcellular Location
Cytoplasmic granule. Note=Cytoplasmic granules of eosinophils.
Protein Families
Peroxidase family, XPO subfamily
Database Links

HGNC: 3423

OMIM: 131399

KEGG: hsa:8288

STRING: 9606.ENSP00000225371

UniGene: Hs.279259

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×