Recombinant Human Eukaryotic translation initiation factor 1A, X-chromosomal (EIF1AX)

In Stock
Code CSB-EP007506HU
Abbreviation Recombinant Human EIF1AX protein
MSDS
Size $256
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
eIF-1A X isoform;Eukaryotic translation initiation factor 4C;eIF-4C
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-144aa
Target Protein Sequence
MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.4 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.
Gene References into Functions
  1. Its mutation is found in patients with meningeal melanocytic tumor. PMID: 29476293
  2. Study identified a new RNA-induced silencing complex component, eIF1A, which directly interacts with the MID-domain of Ago2 and functions in DICER-independent miRNA biogenesis and miRNA-mediated RNA interference. PMID: 29236257
  3. EIF1AX alterations occurred infrequently in low-grade gliomas (1.4%), uterus endometrial carcinoma (1.25%), thyroid carcinoma (1%), and lung adenocarcinoma (0.4%). PMID: 27089234
  4. In this report we show that patients with uveal melanoma harbor mutation-specific chromosomal patterns in the tumor. These chromosomal patterns are characterized by different types of chromosomal anomalies, thus illustrating that distinct biological mechanisms underlie uveal melanoma pathogenesis. PMID: 27916271
  5. Coexpression of mutant NRAS and EIF1AX proteins promoted proliferation and clonogenic survival in LGSC cells, providing the first example of co-occurring, growth-promoting mutational events in ovarian cancer. PMID: 28646021
  6. Short 5'UTR mRNAs are enriched with TISU (translation initiator of short 5'UTR), a 12-nucleotide element directing efficient scanning-independent translation. This study demonstrate that TISU is particularly dependent on eukaryotic initiation factor 1A (eIF1A) which interacts with both RPS3 and RPS10e. PMID: 28584194
  7. Mutation in EIF1AX gene is associated with Uveal Melanoma. PMID: 28810145
  8. we find iris melanomas to be related genetically to choroidal and ciliary body melanomas, frequently harboring GNAQ, GNA11, and EIF1AX mutations. PMID: 28700778
  9. results indicate that the interactions between eIF1A and eIF5B are being continuously rearranged during translation initiation; presentation of a model how the dynamic eIF1A/eIF5B interaction network can promote remodeling of the translation initiation complexes, and the roles in the process played by intrinsically disordered protein segments PMID: 27325746
  10. Patients with uveal melanoma can be classified into 3 groups, of which EIF1AX-mutated tumors and tumors without BAP1, SF3B1, or EIF1AX mutations are associated with prolonged survival and low metastatic risk, SF3B1-mutated tumors are associated with late metastasis PMID: 26923342
  11. BAP1, SF3B1, and EIF1AX mutations occur during uveal melanoma tumor progression in an almost mutually exclusive manner and are associated with different levels of metastatic risk. PMID: 27123562
  12. We report here the occurrence of EIF1AX mutations not only in thyroid cancer, but also in benign thyroid nodules, and demonstrate that phenotypically these mutations are associated with the encapsulated follicular variant of papillary thyroid carcinoma and benign follicular-pattern nodules. PMID: 26911375
  13. The finding of this study suggested that an SF3B1 or EIF1AX mutation is present in a substantial subset of primary LMNs underscores that these tumors genetically resemble uveal melanoma and are different from cutaneous melanoma at the genetic level. PMID: 26769193
  14. The effect of an EIF1AX mutation is estimated to be a decreased odds of metastasis in uveal melanoma. PMID: 24970262
  15. the newly identified driver mutations in EIF1AX and SF3B1, specifically found in uveal melanomas with disomy 3, confirm and extend the established classification model of uveal melanoma. PMID: 23793026
  16. Coordinated movements of eukaryotic translation initiation factors eIF1, eIF1A, and eIF5 trigger phosphate release from eIF2 in response to start codon recognition by the ribosomal preinitiation complex PMID: 23293029
  17. eIF3j/HCR1 closely cooperates with the eIF3b/PRT1 RNA recognition motif and eIF1A on the ribosome to ensure proper formation of the scanning-arrested conformation required for stringent AUG recognition PMID: 20060839
  18. Remarkable conservation of translation initiation factors: IF1/eIF1A and IF2/eIF5B are universally distributed phylogenetic markers. PMID: 11699879
  19. Exp5 exports eEF1A via tRNA from nuclei and synergizes with other transport pathways to confine translation to the cytoplasm. PMID: 12426392
  20. determination of binding site on eukaryotic initiation factor 5B PMID: 12569173
  21. The efficiency of the EF-1alpha promoter was higher than that of the cytomegalovirus promoter in all embryonic stem cells trnasfected. PMID: 17784828

Show More

Hide All

Protein Families
EIF-1A family
Database Links

HGNC: 3250

OMIM: 300186

KEGG: hsa:107984923

STRING: 9606.ENSP00000368927

UniGene: Hs.522590

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*