Recombinant Human FAD-linked sulfhydryl oxidase ALR (GFER), partial

Code CSB-YP009370HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP009370HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP009370HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP009370HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP009370HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
ALR_HUMAN; Augmenter of liver regeneration; ERV1; ERV1 homolog; Erv1 like growth factor; FAD-linked sulfhydryl oxidase ALR; GFER; Growth factor augmenter of liver regeneration; Growth factor erv1 like; Hepatic regenerative stimulation substance; Hepatopoietin; Hepatopoietin protein; hERV1; HPO; HPO1; HPO2; HSS
Species
Homo sapiens (Human)
Expression Region
81-205aa
Target Protein Sequence
MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFY PCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWK DGSCD
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
FAD-dependent sulfhydryl oxidase that regenerates the redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding in the mitochondrial intermembrane space. The reduced form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with GFER/ERV1, resulting in regeneration of the essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 becomes re-oxidized by donating electrons to cytochrome c or molecular oxygen.; May act as an autocrine hepatotrophic growth factor promoting liver regeneration.
Gene References into Functions
  1. Data (including data from studies in knockout mice) suggest that KIBRA plays important role in regulating HPO activity, YAP signaling, and actin cytoskeletal dynamics in podocytes; expression of KIBRA and YAP plus phosphorylation of YAP are up-regulated in glomeruli of patients with focal segmental glomerulosclerosis. (KIBRA = kidney/brain protein-KIBRA; HPO = hepatopoietin protein; YAP = Yes associated protein-1) PMID: 28982981
  2. Loss of DLG5 expression promoted breast cancer progression by inactivating the Hippo signaling pathway and increasing nuclear YAP. PMID: 28169360
  3. WWC2 functions as a tumor suppressor by negatively regulating the Hippo signaling pathway and may serve as a prognostic marker in hepatocellular carcinoma. PMID: 28815883
  4. the results of this study demonstrated that targeted inhibition of the ALR expression in Jurkat cells triggered cell growth inhibition and sensitized cells to VCR via promoting apoptosis and regulating the cell cycle. PMID: 29048676
  5. IKBKE plays a pivotal role in regulating cell proliferation, invasion and epithelial-mesenchymal transition of malignant glioma cells in vitro and in vivo by impacting on the Hippo pathway. PMID: 28548934
  6. we found 2 additional patients carrying compound heterozygous variants in GFER. Reverse phenotyping confirmed the phenotypical similarities between the 4 patients. Together with the first literature reports, the review of these 8 cases from 4 unrelated families enables us to better describe this apparently homogeneous disorder, with the clinical and biological stigmata of mitochondrial disease PMID: 28155230
  7. ese findings collectively indicate that ALR negatively regulates the autophagy process through an association with the AMPK/mTOR signaling pathway. Autophagy inhibit apoptosis and play a protective role under conditions of oxidative stress. PMID: 28466106
  8. HPO interaction with MOB1 is not essential for development and tissue growth control. PMID: 28947795
  9. Overexpression of augmenter of liver regeneration (ALR) in liver cancer was studied and found to improve sensitivity to antitumor drugs by increasing the retention of intracellular drugs, at least partly through the modulation of the ABCB1 and ABCG2 signaling pathway. PMID: 28825695
  10. role in regulating the mitochondrial fission machinery PMID: 28646508
  11. It evidence demonstrating Hippo-independent regulation of TEADs and the potential impacts these studies may have on new cancer therapeutics. PMID: 28964625
  12. ALR protects steatotic hepatocytes from ischemia reperfusion injury by attenuating oxidative stress and mitochondrial dysfunction. PMID: 28704337
  13. Our results show that MARK4 acts as a negative regulator of the Hippo kinase cassette to promote YAP/TAZ activity and that loss of MARK4 restrains the tumorigenic properties of breast cancer cells. PMID: 28183853
  14. ALR, dependent on its localization, changes the acute-phase response (APR) at least in part, by modifying STAT3 activation; dual signaling of ALR suggests that ALR is pivotal for the regulation of APR, a crucial event in liver injury and regeneration PMID: 28506765
  15. the mechanistic regulation and linkage of the ROR1-HER3 and Hippo-YAP pathway in a cancer-specific context PMID: 28114269
  16. S100A7 induction by the Hippo-YAP pathway in cervical and glossopharyngeal squamous cell carcinoma has been described. PMID: 27907036
  17. ALR protects cells from apoptosis partly through increased autophagy in HepG2 cells. PMID: 25954098
  18. Knockdown of GFER exerts anti-inflammatory actions via suppression of the mitogen-activated protein kinase signaling pathway PMID: 25929436
  19. ALR plays a protective role against hydrogen peroxide-induced oxidative stress in renal proximal tubule cells. PMID: 25633409
  20. Data show that the over-expression of 23 kDa augmenter of liver regeneration (ALR) in hepatic cell line LO2 cells promoted the cell proliferation and enhanced cell resistance to hydrogen peroxide. PMID: 26271971
  21. Upregulation of miR-130b enhances stem cell-like phenotype in glioblastoma by inactivating the Hippo signaling pathway. PMID: 26241672
  22. This review summarizes the current findings of the regulation of Hippo signaling in liver regeneration and tumorigenesis, focusing on how the loss of tumor suppressor components of the Hippo pathway results in liver cancers. [review] PMID: 25476204
  23. Here we provide an overview of its roles in regulating stem cells in epithelial tissues and its potential implications in related cancers. [review] PMID: 25476205
  24. The purpose of this review is to summarize the recent findings and discuss how Hippo pathway responds to cellular stress and regulates early development events, tissue homeostasis as well as tumorigenesis. [review] PMID: 25476206
  25. this review, we briefly describe the components of the Hippo pathway and focus on the recent progress with respect to the regulation of the Hippo pathway by GPCRs and G proteins in cancer cells. [review] PMID: 25491506
  26. Control of growth and beyond: a special issue on Hippo signaling PMID: 25467756
  27. This review will discuss and summarize the roles of several core components of the Hippo pathway in mammary gland development and breast cancer. [review] PMID: 25467757
  28. In this review, we discuss the roles of non-canonical Hippo/Mst signaling pathways in lymphocyte development and functions. [review] PMID: 25487919
  29. ALR is involved in the progression of renal fibrosis and administration of rhALR protects the kidney against renal fibrosis by inhibition of TGF-beta/Smad activity. PMID: 24844766
  30. Enhanced ALR gene expression was negatively correlated with advanced histopathological grade and stage in both colon cancer cell lines and human tissue samples. PMID: 25778301
  31. A model for the functional defect in Erv1 R182H, which could potentially be extended to human ALR R194H and provides insights into the molecular basis of autosomal recessive myopathy. PMID: 25269795
  32. ALR, Bcl-2 protein, clusterin and reactive oxygen species expression in muscle tissue biopsies from mitochondrial myopathy-affected patients, was determined. PMID: 23916837
  33. protects Jurkat T leukemia cells from vincristine-induced cell death PMID: 23810409
  34. the protective effect of hepatic stimulator substance against endoplasmic reticulum stress may be associated with the removal of reactive oxygen species to restore the activity of the sarco-endoplasmic reticulum Ca(2+)-ATPase. PMID: 24284796
  35. These results collectively suggest that the Hippo pathway negatively regulates the actin-binding activity of Amot family members through direct phosphorylation. PMID: 24225952
  36. Import and oxidative folding of proteins are kinetically and functionally coupled and depend on the expression of Mia40, ALR, and the intracellular glutathione pool. PMID: 23676665
  37. this work studies the catalytic mechanism of the short, cytokine form of augmenter of liver regeneration using model thiol substrates of the enzyme PMID: 24147449
  38. Nrf2 activates ALR via antioxidant response element and links oxidative stress to liver regeneration. PMID: 23887691
  39. Small molecule MitoBloCK-6 inhibits Erv1/ALR and thus mitochondrial protein import in human embryonic stem cells. PMID: 23597483
  40. overexpression of hALR results in influencing the sperm morphology and quantity and the eventual reduction in male fertility. PMID: 22863717
  41. refined 2.4 A resolution of ALR structure is in good agreement with both the X-ray data (R(cryst) of 0.165, R(free) of 0.211) PMID: 22948913
  42. The unstructured domain performs a dual function in two cellular compartments: it acts (i) as a mitochondrial targeting signal in the cytosol and (ii) as a crucial recognition site in the disulfide relay system of intermembrane space. PMID: 23207295
  43. ALR level in serum may indicate hepatocyte proliferation or liver regeneration. High ALR level in serum in early stage of acute-on-chrinic liver failure may mean a good prognosis. PMID: 22246190
  44. The role of ALR is activated caspase-3, ROS, apoptotic cell number and mitochondrial degeneration. PMID: 22476097
  45. The study shows the mechanism of the electron flux within ALR, characterizing at the atomic level the ALR intermediates that allow electrons to rapidly flow to cytochrome c. PMID: 22224850
  46. The role for Gfer is the restriction of unwarranted proliferation in HSCs through the inhibition of Jab1 and subsequent stabilization and nuclear retention of p27kip1. PMID: 21636978
  47. Data indicate that cytosolic ALR reduces hepatoma cell migration, augments epithelial growth and, therefore, may act as an antimetastatic and EMT reversing protein. PMID: 21152698
  48. Molecular recognition and substrate mimicry drive the electron-transfer process between MIA40 and ALR. PMID: 21383138
  49. Mutation in the GFER gene causes an infantile mitochondrial disorder. GFER mutation in patient's muscle causes: a reduction in complex I, II, and IV activity; abnormal morphology of the mitochondria; and mtDNA multiple deletions. PMID: 19409522
  50. [review] Chronic lack of action by hepatic insulin-sensitizing substance (HISS) results in a progressive and predictable series of homeostatic dysfunctions typical of type 2 diabetes. PMID: 20393596

Show More

Hide All

Involvement in disease
Myopathy, mitochondrial progressive, with congenital cataract, hearing loss and developmental delay (MPMCHD)
Subcellular Location
[Isoform 1]: Mitochondrion intermembrane space. Mitochondrion.; [Isoform 2]: Cytoplasm. Secreted.
Tissue Specificity
Ubiquitously expressed. Highest expression in the testis and liver and low expression in the muscle.
Database Links

HGNC: 4236

OMIM: 600924

KEGG: hsa:2671

STRING: 9606.ENSP00000248114

UniGene: Hs.27184

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1