Home
Protein
Recombinant Proteins
Recombinant Human FUN14 domain-containing protein 1 (FUNDC1), partial, Biotinylated

Recombinant Human FUN14 domain-containing protein 1 (FUNDC1), partial, Biotinylated

^{In Stock}

Code	CSB-EP816886HU-B
Abbreviation	Recombinant Human FUNDC1 protein, partial, Biotinylated
MSDS	MSDS Datasheet
Size	$308
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

≥95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

FUNDC1

Uniprot No.

Q8IVP5

Research Area

Signal Transduction

Alternative Names

FUNDC1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

96-133aa

Target Protein Sequence

QIDWKRVEKDVNKAKRQIKKRANKAAPEINNLIEEATE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

52.2 kDa

Protein Length

Partial

Tag Info

N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Acts as an activator of hypoxia-induced mitophagy, an important mechanism for mitochondrial quality control.

Gene References into Functions

Our data suggested that FUNDC1 can be used as a prognostic biomarker in patients with cervical cancer, and may be a new therapeutic target to improve the antitumor effects of chemoradiotherapy. PMID: 28719148
phosphorylation of Tyr18 of FUNDC1 serves as a molecular switch for mitophagy. PMID: 27653272
FUNDC1 integrates mitochondrial fission and mitophagy at the interface of the endoplasmic reticulum-mitochondrial contact site by working in concert with DRP1 and calnexin under hypoxic conditions in mammalian cells. PMID: 27145933
FUNDC1 regulates both mitochondrial fission or fusion and mitophagy. PMID: 27050458
The BCL2L1-PGAM5-FUNDC1 axis is critical for receptor-mediated mitophagy. PMID: 25126723
FUNDC1 regulates ULK1 recruitment to damaged mitochondria, where FUNDC1 phosphorylation by ULK1 is crucial for mitophagy. PMID: 24671035
Data show that Knockdown of endogenous FUNDC1 significantly prevented hypoxia-induced mitophagy, which could be reversed by the expression of wild-type FUNDC1. PMID: 22267086