Recombinant Human Fibroblast growth factor 21 (FGF21)

In Stock
Code CSB-EP008627HU
Abbreviation Recombinant Human FGF21 protein
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
FGF-21
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
29-209aa
Target Protein Sequence
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human FGF21 protein is expressed with the N-terminal 6xHis-tag in E. coli. The gene fragment encoding the 29-209aa of FGF21 protein is cloned into a suitable expression vector. The 6xHis-tag gene is also inserted into the vector. The recombinant vectors are transfected into E. coli cells. Upon IPTG induction, the recombinant FGF21 protein is expressed at high levels and is subsequently purified from the cell lysate using Ni-NTA affinity chromatography. This method takes advantage of the interaction between the 6xHis tag and nickel ions in the resin. Following purification, SDS-PAGE analysis reveals a protein purity exceeding 90%.

Human FGF21 functions primarily as an endocrine hormone, playing a crucial role in the regulation of glucose and lipid metabolism. FGF21 is predominantly expressed in the liver, adipose tissue, skeletal muscle, and other organs, and its secretion is significantly influenced by metabolic states such as fasting and obesity [1][2][3].

FGF21 has garnered attention for its metabolic regulatory functions. It has been shown to enhance glucose uptake in adipocytes and increase insulin sensitivity, making it a potential therapeutic target for metabolic disorders such as type 2 diabetes and obesity [4][5][6]. In experimental models, FGF21 administration has been associated with improved metabolic profiles, including reduced plasma glucose and triglyceride levels, and protection against diet-induced obesity [4][6][7]. The hormone's effects are mediated through its interaction with specific receptors, notably the FGFR1 in conjunction with the co-receptor βKlotho, which is essential for FGF21 signaling [3][8].

Beyond glucose and lipid metabolism, FGF21 has been implicated in the regulation of energy expenditure and thermogenesis, particularly in brown adipose tissue (BAT) [9][10]. FGF21 levels are elevated during fasting, suggesting its role in adapting to energy deficits by promoting fatty acid oxidation and ketogenesis [11][12]. Additionally, FGF21 has been associated with protective effects against oxidative stress and inflammation, which are critical in various metabolic and cardiovascular diseases [13][14].

References:
[1] Y. Ma, Y. Kuang, W. Bo, Q. Liang, W. Zhu, M. Cai, et al. Exercise training alleviates cardiac fibrosis through increasing fibroblast growth factor 21 and regulating tgf-β1-smad2/3-mmp2/9 signaling in mice with myocardial infarction, International Journal of Molecular Sciences, vol. 22, no. 22, p. 12341, 2021. https://doi.org/10.3390/ijms222212341
[2] J. Yie, R. Hecht, J. Patel, J. Stevens, W. Wang, N. Hawkins, et al. Fgf21 n‐ and c‐termini play different roles in receptor interaction and activation, Febs Letters, vol. 583, no. 1, p. 19-24, 2008. https://doi.org/10.1016/j.febslet.2008.11.023
[3] X. Ding, J. Boney-Montoya, B. Owen, A. Bookout, K. Coate, D. Mangelsdorf, et al. Βklotho is required for fibroblast growth factor 21 effects on growth and metabolism, Cell Metabolism, vol. 16, no. 3, p. 387-393, 2012. https://doi.org/10.1016/j.cmet.2012.08.002
[4] J. Lu, H. Yu, Y. Mo, X. Ma, Y. Hao, W. Lu, et al. Patterns of circulating fibroblast growth factor 21 in subjects with and without type 2 diabetes, Plos One, vol. 10, no. 11, p. e0142207, 2015. https://doi.org/10.1371/journal.pone.0142207
[5] F. Fisher, P. Chui, P. Antonellis, H. Bina, A. Kharitonenkov, J. Flier, et al. Obesity is a fibroblast growth factor 21 (fgf21)-resistant state, Diabetes, vol. 59, no. 11, p. 2781-2789, 2010. https://doi.org/10.2337/db10-0193
[6] K. Mai, J. Andres, K. Biedasek, J. Weicht, T. Bobbert, M. Sabath, et al. Free fatty acids link metabolism and regulation of the insulin-sensitizing fibroblast growth factor-21, Diabetes, vol. 58, no. 7, p. 1532-1538, 2009. https://doi.org/10.2337/db08-1775
[7] P. Højman, M. Pedersen, A. Nielsen, R. Krogh-Madsen, C. Yfanti, T. Åkerström, et al. Fibroblast growth factor-21 is induced in human skeletal muscles by hyperinsulinemia, Diabetes, vol. 58, no. 12, p. 2797-2801, 2009. https://doi.org/10.2337/db09-0713
[8] W. Wei, P. Dutchak, X. Wang, X. Ding, X. Wang, A. Bookout, et al. Fibroblast growth factor 21 promotes bone loss by potentiating the effects of peroxisome proliferator-activated receptor γ, Proceedings of the National Academy of Sciences, vol. 109, no. 8, p. 3143-3148, 2012. https://doi.org/10.1073/pnas.1200797109
[9] S. Keipert, M. Kutschke, M. Ost, T. Schwarzmayr, E. Schothorst, D. Lamp, et al. Long-term cold adaptation does not require fgf21 or ucp1, Cell Metabolism, vol. 26, no. 2, p. 437-446.e5, 2017. https://doi.org/10.1016/j.cmet.2017.07.016
[10] S. Keipert, M. Kutschke, D. Lamp, L. Brachthäuser, F. Neff, C. Meyer, et al. Genetic disruption of uncoupling protein 1 in mice renders brown adipose tissue a significant source of fgf21 secretion, Molecular Metabolism, vol. 4, no. 7, p. 537-542, 2015. https://doi.org/10.1016/j.molmet.2015.04.006
[11] T. Inagaki, P. Dutchak, G. Zhao, X. Ding, L. Gautron, V. Parameswara, et al. Endocrine regulation of the fasting response by pparα-mediated induction of fibroblast growth factor 21, Cell Metabolism, vol. 5, no. 6, p. 415-425, 2007. https://doi.org/10.1016/j.cmet.2007.05.003
[12] Y. Zhang, Y. Xie, E. Berglund, K. Coate, T. He, T. Katafuchi, et al. The starvation hormone, fibroblast growth factor-21, extends lifespan in mice, Elife, vol. 1, 2012. https://doi.org/10.7554/elife.00065
[13] S. Kim, K. Kim, H. Kim, M. Kim, S. Back, M. Konishi, et al., Fibroblast growth factor 21 participates in adaptation to endoplasmic reticulum stress and attenuates obesity-induced hepatic metabolic stress, Diabetologia, vol. 58, no. 4, p. 809-818, 2014. https://doi.org/10.1007/s00125-014-3475-6
[14] G. Ferrer-Curriu, M. Guitart‐Mampel, C. Rupérez, M. Zamora, F. Crispi, F. Villarroya, et al. The protective effect of fibroblast growth factor‐21 in alcoholic cardiomyopathy: a role in protecting cardiac mitochondrial function, The Journal of Pathology, vol. 253, no. 2, p. 198-208, 2020. https://doi.org/10.1002/path.5573

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB. Regulates systemic glucose homeostasis and insulin sensitivity.
Gene References into Functions
  1. The fibroblast growth factor -21 protein was significantly less expressed in liposarcoma than in normal tissue (p<0.05). Fibroblast growth factor -21 protein expression was related to gender, but not age, cell differentiation or tumor size. The patients in the low/no fibroblast growth factor 21 expression group were more likely to relapse and die in a shorter period of time. PMID: 29953859
  2. These findings suggested that the serum FGF21 levels could be involved in a complex adaptive response to insulin secretion and glucose metabolism in humans. PMID: 28225059
  3. Taking together from both physiological and genetic levels, we suggest that FGF21 is inversely associated with regional bone density. PMID: 29299795
  4. besides the NF-kappaB pathway, the mechanism of action of FGF-21 was observed to involve the elevation of IL-10 in the ERK1/2 pathway. PMID: 29427162
  5. ChREBP and FGF21 constitute a signaling axis likely conserved in humans that mediates an essential adaptive response to fructose ingestion that may participate in the pathogenesis of NAFLD and liver fibrosis. PMID: 28123933
  6. Excess dietary carbohydrate, but not fat, led to markedly increased FGF21 secretion in humans, notably without protein restriction, and affected glucose and lipid homeostais. PMID: 28123934
  7. In patients with coronary artery disease at baseline, an elevated serum FGF21 level was associated with development of a major adverse cardiovascular event in the future. PMID: 29462798
  8. Fibroblast growth factor 21 (FGF21) is an atypical member of the FGF family that functions as an endocrine hormone which regulates carbohydrate and lipid metabolism. It is involved in maintaining of energy homeostasis and adaptation to starvation and low temperature. PMID: 30198244
  9. FGF21 is a good predictor of acute-on-chronic liver failure and organ failure, is quite specific for cirrhosis, and seems independent of etiology and systemic inflammation. PMID: 29476704
  10. FGF-21 could regulate the immune response indirectly by influencing the glucose uptake of activated monocytes cells. PMID: 28965199
  11. The genetic defect leads to a disorder of mitochondrial translation or mtDNA maintenance. PMID: 27794110
  12. FGF21 levels were reduced after energy-restricted treatments and severely increased after bariatric surgery, independently of the weight reduction magnitude, insulin sensitivity or ketosis; therefore, FGF21 appears to be a marker of severe nutritional stress PMID: 28588304
  13. In HIV-infected individuals, FGF21 is significantly positively associated with liver fat. FGF21 decreases in association with reductions in liver fat, GGT, and FIB4, suggesting that FGF21 is upregulated in the context of steatosis and steatohepatitis and is reduced when these conditions improve PMID: 29031905
  14. crystal structures of free and ligand-bound beta-klotho extracellular regions that reveal the molecular mechanism that underlies the specificity of FGF21 towards beta-klotho and demonstrate how the FGFR is activated in a klotho-dependent manner PMID: 29342135
  15. In this review, we will summarize the current progress on the roles of FGF21 against metaflammation and metabolic tissue damage [Review] PMID: 28887067
  16. This finding suggested FGF21 could be involved in the pathophysiology of diastolic heart failure. PMID: 27650781
  17. FGF21 plasma levels correlate negatively with protein intake. PMID: 28078804
  18. Serum FGF21 level was significantly correlated with left ventricular systolic function at baseline and higher levels resulted in greater levels of cardiac death. PMID: 28821258
  19. In conclusion, our study, which focused on hepatic FGF21 and omentin-1 mRNA expression, confirmed marked expression of both molecules in the liver of morbidly obese patients with NAFLD. PMID: 28820393
  20. Serum FGF21 concentrations are decreased in anorexia nervosa and elevated in obesity. They are independently and positively related to BMI and insulin resistance PMID: 28759185
  21. FGF-21 was positively associated with 10-year CHD risk PMID: 28735064
  22. Serum FGF21 level was an independent predictor for new-onset metabolic syndrome in a population-based prospective study. PMID: 29436198
  23. these findings elucidate the involvement of abnormal FGF21 expression in early APAP-induced liver impairment. Interestingly, FGF21 may be a promising biomarker of APAP-exposed livers. PMID: 28591702
  24. Elevated circulating FGF21 level is an independent predictor of incident coronary heard disease in Chinese patients with type 2 diabetes mellitus. PMID: 28588089
  25. Studied the role of fibroblast growth factor 21 (FGF21) in metabolic disorders; found FGF21 levels decreased in obesity, insulin resistance and metabolic syndrome. PMID: 28139438
  26. Data suggest that both osteonectin and FGF21 levels in serum are associated with early nephropathy in type 2 diabetes, albeit with different patterns; persistent hyperglycemia may inhibit bone formation leading to osteoporosis. (FGF21 = fibroblast growth factor 21) PMID: 27916484
  27. As part of the present study, we suggest that both tamoxifen and aromatase inhibitors can reduce FGF-21 levels independently of body compositions, and these drugs can provide antihyperlipidemic, antidiabetic and cardio-protective effects. We also recommend that serum FGF-21 level can be utilized as a tumor biomarker in early-stage breast cancer and for monitoring purposes PMID: 28106545
  28. Data (including data from studies in knockout mice) suggest that dietary manipulations that induce ketosis also lead to increased HPA axis tone; FGF21 knockout mice exhibit blunted HPA response to ketogenic diet relative to wild-type mice; thus, the hepatokine FGF21 appears to play important role in response to ketogenic diet. (HPA axis = hypothalamic-pituitary-adrenal axis) PMID: 29077838
  29. This study revealed statistically significant associations between FGF21 rs838133 and increased consumption of candy, as well as nominal associations with increased alcohol intake and daily smoking. PMID: 28467924
  30. The ability of FGF21 to decrease LDL cholesterol has now been traced to at least two mechanisms: a suppression of hepatocyte expression of sterol response element-binding protein-2 (SREBP-2), which in turn leads to a reduction in cholesterol synthesis; and up-regulated expression of hepatocyte LDL receptors, reflecting inhibition of a mechanism that promotes proteasomal degradation of these receptors. [review] PMID: 26872317
  31. The objective of this review is to compile existing information about the mechanisms that could allow the control of endogenous FGF21 levels in order to obtain the beneficial metabolic effects of FGF21 by inducing its production instead of doing it by pharmacological administration. [review] PMID: 27583468
  32. Fibroblast growth factor 21 (FGF21) gene expression is altered by a wide array of physiological, metabolic, and environmental factors. [review] PMID: 27285327
  33. As there was no significant association between FGF-21 and growth or IGF-1 both in cross-sectional and longitudinal analyses, these findings do not support the hypothesis that FGF-21 is involved in growth of obese children. PMID: 26887040
  34. This mini-review aims to summarize the current state of knowledge about the role of FGF21 in cardiovascular disorders, and discuss the molecular mechanism underlying the anti-atherogenic properties of this compound. [review] PMID: 27305706
  35. FGF21 has received particular attention because of its key role in carbohydrate, lipids, and energy balance regulation. FGF21 has an anti-oxidant function in human metabolic diseases which contribute to understanding the FGF21 compensatory increment in obesity, the metabolic syndrome, and type 2 diabetes. [review] PMID: 27318658
  36. cholestasis could induce FGF21 expression in FXR dependent manner PMID: 27003131
  37. Serum concentrations of FGF21 are elevated in patients with non-HIV lipodystrophy with adipose tissue and liver being potential sources of increased production. TG and fibrate treatment are independent positive predictors of circulating FGF21. PMID: 27179139
  38. FGF21 concentration in plasma is increased in patients with obesity, insulin resistance, and metabolic syndrome. Recent findings suggest that such increment protects tissue from an increased oxidative stress environment. (Review) PMID: 28039838
  39. FGF21 appears to act in a paracrine manner to increase glucose uptake under low insulin conditions, but it does not contribute to the resistance to diet-induced obesity. PMID: 27184848
  40. Insulin rather than glucose per se increases total and bioactive FGF21 in the postprandial period in adult humans. PMID: 28938434
  41. FGF21 has a role in promoting remyelination in the central nervous system PMID: 28825598
  42. FGF21 genotypes may interact with dietary carbohydrate/fat intake on changes in central adiposity and body fat composition. A low-calorie, high-carbohydrate/low-fat diet was beneficial for overweight or obese individuals carrying the carbohydrate intake-decreasing allele of the FGF21 variant to improve body composition and abdominal obesity. PMID: 27581055
  43. Higher vitamin D status, but not FGF21, was associated with greater postprandial glucose oxidation and improved insulin sensitivity in metabolic syndrome. PMID: 28359360
  44. dietary protein dilution promotes improved glucose homeostasis through an select nonessential amino acids insufficiency-induced liver NUPR1/FGF21 axis PMID: 27548521
  45. In Japanese men, acute endurance exercise lowers serum FGF21 levels 24 h following exercise. The results suggest that acute endurance exercise modulates postprandial FGF21 metabolism regardless of age. PMID: 27453549
  46. Higher circulating FGF21 levels were associated with a high mortality rate, but not cardiovascular events in patient with end-stage renal disease, suggesting that circulating FGF21 levels serve as a predictive marker for mortality in these subjects. PMID: 28582462
  47. FGF21 is not critical for bone homeostasis or actions of PPARalpha and PPARgamma. PMID: 27505721
  48. miR-149 could negatively regulate the protein expression level of FGF-21. PMID: 27061435
  49. As a biomarker for diabetes prediction, serum FGF21 appeared to be superior to other adipokines and, on its own, could be considered as an alternative to the oral glucose tolerance test. PMID: 27611701
  50. Serum FGF21 rises significantly in humans with acute pancreatitis. The pancreas may be contributing to increased FGF21 levels following injury and FGF21 may play a role in the recovery process. PMID: 27832059

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Database Links

HGNC: 3678

OMIM: 609436

KEGG: hsa:26291

STRING: 9606.ENSP00000222157

UniGene: Hs.283015

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*