Recombinant Human Forkhead box protein P1(FOXP1),partial

Code CSB-EP008841HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. Q9H334
Relevance Transcriptional repressor . Can act with CTBP1 to synergistically repress transcription but CTPBP1 is not essential . Plays an important role in the specification and differentiation of lung epithelium. Acts cooperatively with FOXP4 to regulate lung secretory epithelial cell fate and regeneration by restricting the goblet cell lineage program; the function may involve regulation of AGR2. Essential transcriptional regulator of B-cell development. Involved in regulation of cardiac muscle cell proliferation. Involved in the columnar organization of spinal motor neurons. Promotes the formation of the lateral motor neuron column (LMC) and the preganglionic motor column (PGC) and is required for respective appropriate motor axon projections. The segment-appropriate generation of spinal chord motor columns requires cooperation with other Hox proteins. Can regulate PITX3 promoter activity; may promote midbrain identity in bryonic st cell-derived dopamine neurons by regulating PITX3. Negatively regulates the differentiation of T follicular helper cells T(FH)s. Involved in maintainance of hair follicle st cell quiescence; the function probably involves regulation of FGF18 . Represses transcription of various pro-apoptotic genes and cooperates with NF-kappa B-signaling in promoting B-cell expansion by inhibition of caspase-dependent apoptosis . Binds to CSF1R promoter elents and is involved in regulation of monocyte differentiation and macrophage functions; repression of CSF1R in monocytes ses to involve NCOR2 as corepressor . Involved in endothelial cell proliferation, tube formation and migration indicative for a role in angiogenesis; the role in neovascularization ses to implicate suppression of SA5B . Can negatively regulate androgen receptor signaling .
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Mac-1-regulated forkhead1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLLQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQ
Research Area Transcription
Source E.coli
Gene Names FOXP1
Expression Region 1-114aa
Tag Info N-terminal GST-tagged
Mol. Weight 39.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Transcriptional repressor
Involvement in disease Mental retardation with language impairment and autistic features (MRLIAF)
Subcellular Location Nucleus
Tissue Specificity Isoform 8 is specifically expressed in embryonic stem cells.
Database Links

HGNC: 3823

OMIM: 605515

KEGG: hsa:27086

STRING: 9606.ENSP00000318902

UniGene: Hs.59368

Related Products

FOXP1 Antibodies

FOXP1 Antibodies for Homo sapiens (Human)

FOXP1 Antibodies for Human

FOXP1 Proteins

FOXP1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.