Recombinant Human Gamma-aminobutyric acid receptor-associated protein-like 2 (GABARAPL2)

Code CSB-EP009132HU
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
GABARAPL2
Uniprot No.
Research Area
Transport
Alternative Names
ATG8; ATG8C; FLC3A; GABA(A) receptor-associated protein-like 2; Gabarapl2; Gamma-aminobutyric acid receptor-associated protein-like 2; Ganglioside expression factor 2; GATE-16; GATE16; GBRL2_HUMAN; GEF-2; GEF2; General protein transport factor p16; Golgi-associated ATPase enhancer of 16 kDa; MAP1 light chain 3-related protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-117aa
Target Protein Sequence
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
40.7kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ubiquitin-like modifier involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. Involved in autophagy. Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.
Gene References into Functions
  1. This study reveals the important role of SERP1/Ysy6 and Atg8 in endoplasmic reticulum stress response and virulence in Candida albicans. PMID: 29544880
  2. Mechanism of cargo-directed Atg8 conjugation during selective autophagy has been described. PMID: 27879200
  3. rs12599322 in ATG8 was significantly associated with higher DNA damage levels in Chinese population. PMID: 28512061
  4. describe a protocol for the reconstituted conjugation systems for mammalian Atg8 homologs in vitro using purified recombinant Atg proteins and liposomes. PMID: 25181299
  5. Using X-ray crystallography and NMR spectroscopy, the structural transition centered on the C-terminus of GATE-16 protein was identified. PMID: 26284781
  6. Results showed that the mRNA and protein levels of GABARAPL1 and GATE-16 were decreased in the cerebellum of multiple system atrophy relative to controls PMID: 22959883
  7. Lipidation of the LC3/GABARAP family of autophagy proteins relies on a membrane-curvature-sensing domain in Atg3. PMID: 24747438
  8. these results suggest that TRPML3 plays a role in autophagosome maturation through the interaction with GATE16, by providing Ca(2+) in the fusion process. PMID: 24269818
  9. low GABARAPL2/GATE-16 expression is associated with an immature myeloid leukemic phenotype and these proteins are necessary for neutrophil differentiation of APL cells PMID: 23891751
  10. TP53INP1, a tumor suppressor, interacts with LC3 and ATG8-family proteins through the LC3-interacting region (LIR) and promotes autophagy-dependent cell death. PMID: 22421968
  11. ATG8 proteins act as scaffolds for assembly of the ULK complex at the phagophore PMID: 23043107
  12. Legionella pneumophila could interfere with autophagy by using the bacterial effector protein RavZ to directly uncouple Atg8 proteins attached to phosphatidylethanolamine on autophagosome membranes. [RavZ] PMID: 23112293
  13. Binding of the Atg1/ULK1 kinase to the ubiquitin-like protein Atg8 regulates autophagy PMID: 22885598
  14. identified 14 TBC domain-containing Rab GAPs that bind directly to ATG8 modifiers and that colocalize with LC3-positive autophagy membranes in cells PMID: 22354992
  15. ORP7 negatively regulates GS28 protein stability via sequestration of GATE-16, and may mediate the effect of 25-OH on GS28 and Golgi function. PMID: 21669198
  16. The GATE-16 N termini in general and specific residues needed for the fusion activity are essential for the proteins role in autophagosome biogenesis. PMID: 21497758
  17. Atg4B possessed the broadest spectrum against all substrates, followed by Atg4A for ATG8 substrates PMID: 21177865
  18. The results indicate the essential role of the Atg8 system in the proper development of autophagic isolation membranes in mice. PMID: 18768753
  19. The autophagy-unrelated association of GFP-LC3 with protein aggregates is dependent on its interaction with p62. PMID: 18776740

Show More

Hide All

Subcellular Location
Cytoplasmic vesicle, autophagosome. Endoplasmic reticulum membrane. Golgi apparatus.
Protein Families
ATG8 family
Tissue Specificity
Ubiquitous. Expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. Expressed at very low levels in lung, thymus and small intestine.
Database Links

HGNC: 13291

OMIM: 607452

KEGG: hsa:11345

STRING: 9606.ENSP00000037243

UniGene: Hs.461379

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*