| Code | CSB-EP009565HU |
| Size |
$1812Purchase it in Cusabio online store (only available for customers from the US) |
| Image |
|
| Have Questions? | Leave a Message or Start an on-line Chat |
| Description |
The production of this recombinant Human GM2A protein is just like all recombinant proteins. The process involved transfecting E.coli cells with DNA vector containing the template of recombinant DNA. The E.coli cells containing the template were then cultured so that they could transcribe and translate the GM2A protein. N-terminal 6xHis-SUMO tag was used in the process. The purity is 85% determined by SDS-PAGE. (The activity of this GM2A protein has been validated.) The GM2A gene provides instructions for making a protein named ganglioside GM2 activator (also called cerebroside sulfate activator protein (GM2AP), sphingolipid activator protein 3 (SAP3)). The GM2A protein is involved in various biological processes, including ganglioside catabolic process, lipid storage and transport, neuromuscular process controlling balance, etc. The mature form of ganglioside GM2 activator protein is a small (20 kDa), a heat-stable, long-lived, protease-resistant glycosylated protein that normally resides in the lysozyme. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Target Names | GM2A |
| Uniprot No. | P17900 |
| Research Area | Signal Transduction |
| Alternative Names | Cerebroside sulfate activator protein; ganglioside GM2 activator; Ganglioside GM2 activator isoform short; Ganglioside GM2 activator precursor; GM2 activator; GM2 AP; GM2 ganglioside activator; GM2 ganglioside activator protein; GM2-AP; GM2A; GM2AP; OTTHUMP00000160619; SAP 3; SAP-3; SAP3; SAP3_HUMAN; Shingolipid activator protein 3; Sphingolipid activator protein 3 |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 32-193aa |
| Target Protein Sequence | SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 33.6 kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info |
N-terminal 6xHis-SUMO-tagged |
| Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs |
Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
| Function |
The large binding pocket can accommodate several single chain phospholipids and fatty acids, GM2A also exhibits some calcium-independent phospholipase activity. Binds gangliosides and stimulates ganglioside GM2 degradation. It stimulates only the breakdown of ganglioside GM2 and glycolipid GA2 by beta-hexosaminidase A. It extracts single GM2 molecules from membranes and presents them in soluble form to beta-hexosaminidase A for cleavage of N-acetyl-D-galactosamine and conversion to GM3. Has cholesterol transfer activity.
|
| Gene References into Functions |
|
| Involvement in disease | GM2-gangliosidosis AB (GM2GAB) |
| Subcellular Location | Lysosome. |
| Database Links |
HGNC: 4367 OMIM: 272750 KEGG: hsa:2760 STRING: 9606.ENSP00000349687 UniGene: Hs.483873 |
