Recombinant Human Glutamate receptor ionotropic, NMDA 2A(GRIN2A),partial

Code CSB-EP618634HU1
Product Type Recombinant Protein
Size $1726
Uniprot No. Q12879
Relevance NMDA receptor subtype of glutamate-gated ion channels possesses high calcium permeability and voltage-dependent sensitivity to magnesium. Activation requires binding of agonist to both types of subunits.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias Glutamate [NMDA] receptor subunit epsilon-1N-methyl D-aspartate receptor subtype 2A ;NMDAR2A ;NR2A ;hNR2A
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTI
Research Area Transport
Source E.coli
Gene Names GRIN2A
Expression Region 501-550aa & 601-630aa & 701-750aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 18.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+)
Involvement in disease Epilepsy, focal, with speech disorder and with or without mental retardation (FESD)
Subcellular Location Cell membrane, Multi-pass membrane protein, Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein
Protein Families Glutamate-gated ion channel (TC 1.A.10.1) family, NR2A/GRIN2A subfamily
Database Links

HGNC: 4585

OMIM: 138253

KEGG: hsa:2903

STRING: 9606.ENSP00000332549

UniGene: Hs.411472

Pathway Calcium signaling pathway
cAMP signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Glutamatergic synapse

Related Products

GRIN2A Antibodies

GRIN2A Antibodies for Homo sapiens (Human)

GRIN2A Antibodies for Human

GRIN2A Proteins

GRIN2A Proteins for Homo sapiens (Human)

GRIN2A ELISA Kit

GRIN2A ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.