Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
AL033363; Cellular glutathione peroxidase; Glutathione peroxidase 1; Glutathione peroxidase; GPx 1; GPx-1; GPX1; GPX1_HUMAN; GPXD; GSHPx-1; GSHPX1; MGC14399; MGC88245
Species
Homo sapiens (Human)
Expression Region
1-203aa(U49S)
Target Protein Sequence
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLSGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 1-203(U49S) constitute the expression domain of recombinant Human GPX1. The calculated molecular weight for this GPX1 protein is 26.1 kDa. This GPX1 protein is produced using e.coli expression system. The GPX1 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant GPX1 protein during the following stages.
Human glutathione peroxidase 1 (GPX1) is a key antioxidant enzyme that plays a crucial role in protecting cells from oxidative damage. GPX1 belongs to the family of glutathione peroxidases, and its primary function is to catalyze the reduction of hydrogen peroxide and organic hydroperoxides using glutathione as a reducing agent. By scavenging reactive oxygen species (ROS), GPX1 helps maintain cellular redox balance and protects biomolecules such as lipids and DNA from oxidative stress. GPX1 is widely distributed in various tissues, with particularly high levels in the liver. Understanding the function of GPX1 is essential for unraveling the complex interplay between antioxidants and oxidative stress, providing insights into potential therapeutic strategies for conditions associated with oxidative damage.