Recombinant Human Glutathione peroxidase 1(GPX1)

Code CSB-EP009866HUa2
Product Type Recombinant Protein
Size US$1726
Uniprot No. P07203
Relevance Protects the hoglobin in erythrocytes from oxidative breakdown.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Cellular glutathione peroxidase
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLSGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
Source E.coli
Gene Names GPX1
Expression Region 1-203aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 38.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Protects the hemoglobin in erythrocytes from oxidative breakdown.
Subcellular Location Cytoplasm
Protein Families Glutathione peroxidase family
Database Links

HGNC: 4553

OMIM: 138320

KEGG: hsa:2876

STRING: 9606.ENSP00000407375

UniGene: Hs.76686

Pathway Th17 cell differentiation
Cell ageing and metabolism

Related Products

GPX1 Antibodies

GPX1 Antibodies for Human

GPX1 Antibodies for Homo sapiens (Human)

GPX1 Proteins

GPX1 Proteins for Homo sapiens (Human)

GPX1 ELISA Kit

GPX1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.