Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA),partial

Code CSB-EP006046HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P15509
Relevance Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hatopoietic cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CDw116; CD116
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG
Research Area Immunology
Source E.coli
Gene Names CSF2RA
Expression Region 23-320aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 50.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.
Involvement in disease Pulmonary surfactant metabolism dysfunction 4 (SMDP4)
Subcellular Location Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted
Protein Families Type I cytokine receptor family, Type 5 subfamily
Database Links

HGNC: 2435

OMIM: 300770

KEGG: hsa:1438

UniGene: Hs.520937

Pathway Jak-STAT signaling pathway
Hematopoietic cell lineage

Related Products

CSF2RA Antibodies

CSF2RA Antibodies for Homo sapiens (Human)

CSF2RA Antibodies for Human

CSF2RA Proteins

CSF2RA Proteins for Homo sapiens (Human)

CSF2RA ELISA Kit

CSF2RA ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.