Code | CSB-AP003591HU |
Size |
InquiryPurchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined by its ability to inhibit GM-CSF-dependent proliferation of TF?1 human erythroleukemic cells is less than 5 ng/ml. |
Target Names | CSF2RA |
Uniprot No. | P15509 |
Research Area | Immunology |
Alternative Names | CD_antigen=CD116; CD116; CD116 antigen; CDw116; Colony stimulating factor 2 receptor alpha chain; Colony stimulating factor 2 receptor alpha low affinity; Colony stimulating factor 2 receptor alpha subunit; CSF 2R; CSF2R; CSF2R_HUMAN; CSF2RA; CSF2RAX; CSF2RAY; CSF2RX; CSF2RY; GM CSF R alpha; GM CSF receptor alpha subunit; GM-CSF-R-alpha; GMCSFR; GMCSFR-alpha; GMR-alpha; Granulocyte macrophage colony stimulating factor receptor alpha chain; Granulocyte-macrophage colony-stimulating factor receptor subunit alpha; SMDP4 |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 23-320aa |
Complete Sequence | EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG |
Mol. Weight | 35.5 kDa |
Protein Length | Partial |
Tag Info |
C-terminal 6xHis-tagged |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.
|
Gene References into Functions |
|
Involvement in disease | Pulmonary surfactant metabolism dysfunction 4 (SMDP4) |
Subcellular Location | Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Secreted.; [Isoform 4]: Secreted.; [Isoform 6]: Secreted. |
Protein Families | Type I cytokine receptor family, Type 5 subfamily |
Database Links |
HGNC: 2435 OMIM: 300770 KEGG: hsa:1438 UniGene: Hs.520937 |