Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA),partial

In Stock
Code CSB-AP003591HU
Product Type Colony Stimulating Factor
Size $117Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P15509
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha; GM-CSF-R-Alpha; GMCSFR-Alpha; GMR-Alpha; CDw116; CD116; CSF2RA; CSF2R; CSF2RY
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to inhibit GM-CSF-dependent proliferation of TF?1 human erythroleukemic cells is less than 5 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG
Research Area Immunology
Source Mammalian cell
Gene Names CSF2RA
Expression Region 23-320aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 35.5 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.
Involvement in disease Pulmonary surfactant metabolism dysfunction 4 (SMDP4)
Subcellular Location Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted
Protein Families Type I cytokine receptor family, Type 5 subfamily
Database Links

HGNC: 2435

OMIM: 300770

KEGG: hsa:1438

UniGene: Hs.520937

Pathway Jak-STAT signaling pathway
Hematopoietic cell lineage

Related Products

CSF2RA Antibodies

CSF2RA Antibodies for Homo sapiens (Human)

CSF2RA Antibodies for Human

CSF2RA Proteins

CSF2RA Proteins for Homo sapiens (Human)

CSF2RA ELISA Kit

CSF2RA ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.