Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP003591HU |
| Product Type | Colony Stimulating Factor |
| Size |
$117Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | P15509 |
| Image |
|
| Storage Buffer | Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
| Alias | Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha; GM-CSF-R-Alpha; GMCSFR-Alpha; GMR-Alpha; CDw116; CD116; CSF2RA; CSF2R; CSF2RY |
| Species | Homo sapiens (Human) |
| Biological_Activity | The ED50 as determined by its ability to inhibit GM-CSF-dependent proliferation of TF?1 human erythroleukemic cells is less than 5 ng/ml. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG |
| Research Area | Immunology |
| Source | Mammalian cell |
| Gene Names | CSF2RA |
| Expression Region | 23-320aa |
| Tag Info | C-terminal 6xHis-tagged |
| Mol. Weight | 35.5 kDa |
| Protein Description | Partial |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. |
| Involvement in disease | Pulmonary surfactant metabolism dysfunction 4 (SMDP4) |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted |
| Protein Families | Type I cytokine receptor family, Type 5 subfamily |
| Database Links |
HGNC: 2435 OMIM: 300770 KEGG: hsa:1438 UniGene: Hs.520937 |
| Pathway |
Jak-STAT signaling pathway
Hematopoietic cell lineage |
CSF2RA Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA006046GA01HU | CSF2RA Antibody | Human | ELISA,WB,IHC |
| CSB-PA006046KA01HU | CSF2RA Antibody | Human | ELISA,WB,IHC |
| CSB-PA006046LB01HU | CSF2RA Antibody, HRP conjugated | Human | ELISA |
| CSB-PA006046LC01HU | CSF2RA Antibody, FITC conjugated | Human | ELISA |
| CSB-PA006046LD01HU | CSF2RA Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA046967 | CSF2RA Antibody | Human | ELISA,WB |
| CSB-PA005243 | CSF2RA Antibody | Human | WB,ELISA |
| CSB-PA644750 | CSF2RA Antibody | Human | ELISA,WB |
| CSB-PA441042 | CSF2RA Antibody | Human,Mouse | ELISA,WB |
| CSB-PA193987 | CSF2RA Antibody | Human | ELISA,WB,IHC |
CSF2RA Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA006046LA01HU | CSF2RA Antibody | Human | ELISA, IHC, IF |
CSF2RA Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP006046HU CSB-BP006046HU CSB-MP006046HU |
Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA),partial | Yeast Baculovirus Mammalian cell |
| CSB-EP006046HU | Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA),partial | E.coli |
| CSB-CF006046HU | Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA) | in vitro E.coli expression system |
CSF2RA ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL006046HU | Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA) ELISA kit | serum, plasma,tissue homogenates, cell lysates | 4.67 pg/mL |
Recombinant Human Mannan-binding lectin serine protease 1(MASP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Homeobox protein Hox-B4(HOXB4)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Protein-lysine 6-oxidase(LOX)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Collagen alpha-2(IV) chain(Col4a2),partial
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Integrin alpha-IIb(ITGA2B),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Intestinal-type alkaline phosphatase(ALPI)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Butyrophilin subfamily 3 member A1(BTN3A1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
