Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha(CSF2RA)

Code CSB-CF006046HU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P15509
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Sequence EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
Source in vitro E.coli expression system
Gene Names CSF2RA
Protein Names Recommended name: Granulocyte-macrophage colony-stimulating factor receptor subunit alpha Short name= GM-CSF-R-alpha Short name= GMCSFR-alpha Short name= GMR-alpha Alternative name(s): CDw116 CD_antigen= CD116
Expression Region 23-400
Tag Info 10xHis-SUMO-tag
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Low affinity receptor for granulocyte-macrophage colony-stimulating factor. Transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.
Involvement in disease Pulmonary surfactant metabolism dysfunction 4 (SMDP4)
Subcellular Location Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted
Protein Families Type I cytokine receptor family, Type 5 subfamily
Database Links

HGNC: 2435

OMIM: 300770

KEGG: hsa:1438

UniGene: Hs.520937

Pathway Jak-STAT signaling pathway
Hematopoietic cell lineage

Related Products

CSF2RA Antibodies

CSF2RA Antibodies for Homo sapiens (Human)

CSF2RA Antibodies for Human

CSF2RA Proteins

CSF2RA Proteins for Homo sapiens (Human)

CSF2RA ELISA Kit

CSF2RA ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.