Recombinant Human Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G)

Code CSB-EP009164HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
GADD45G
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
CR6; Cytokine responsive protein CR6; Cytokine-responsive protein CR6; DDIT-2; DDIT2; DNA damage-inducible transcript 2 protein; GA45G_HUMAN; Gadd45g; Growth arrest and DNA damage inducible gamma ; Growth arrest and DNA damage-inducible protein GADD45 gamma; GRP17
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-159aa
Target Protein Sequence
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
33.1kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.
Gene References into Functions
  1. In an Eastern Chinese population, carriers of GADD45G rs8252T variant genotypes had a significantly lower risk of NSCLC. rs8252 variant CT/TT carriers showed significantly higher levels of GADD45G mRNA expression than CC carriers in the target tissues. There was some evidence of interactions between rs8252 genotypes and sex in NSCLC risk. PMID: 27861856
  2. In contrast to solid tumors, in DLBCL, the frequency of GADD45gamma methylation is higher and may be associated with progression. Nodal involvement is more likely to be present in patients with unmethylated GADD45gamma. PMID: 25912017
  3. PAX5 was found to be an epigenetically inactivated tumor suppressor that inhibited non-small-cell lung proliferation and metastasis, through down-regulating the beta-catenin pathway and up-regulating GADD45G expression. PMID: 26843424
  4. GADD45G protein, human PMID: 26521045
  5. Results establish that the dowregulation of GADD45G-SIP1 axis may contribute to cellular senescence evasion and HCC development. PMID: 26378039
  6. we demonstrated that GADD45gamma expression in hepatocellular carcinoma cells was associated with sorafenib sensitivity PMID: 26172295
  7. demonstrate for the first time that miR-383 can specifically regulates the expression of Gadd45g by directly targeting to the 3-UTR region of Gadd45g mRNA, a regulatory process conserved in human tumor cells and mouse embryonic stem cells PMID: 25415264
  8. Expression of GADD45gamma was significantly higher in pituitary adenomas of female patients. PMID: 25126861
  9. Suggest that cucurbitacin E induced mitosis delay is regulated by GADD45gamma overexpression in malignant gliomas. PMID: 24577085
  10. GADD45G functions as a negative regulator of the Jak-Stat3 pathway and inhibits hepatocellular carcinoma by inducing cellular senescence. PMID: 23897841
  11. The gadd45g gene has both tumor suppressor and tumor promoter functions, dependent on the tissue/cell type and transforming event. (Review) PMID: 24104471
  12. Decreased expression and aberrant methylation of Gadd45G is associated with tumor progression in esophageal squamous cell carcinoma. PMID: 23793925
  13. Methylation-mediated repression of GADD45G expression is associated with gastric cardia adenocarcinoma. PMID: 23616123
  14. In addition, eight genes classified as 'second tier' hits in the original study (PAX7, THADA, COL8A1/FILIP1L, DCAF4L2, GADD45G, NTN1, RBFOX3 and FOXE1) showed evidence of linkage and association in this replication sample. PMID: 23512105
  15. Knock-down of GADD45gamma significantly attenuates TNF-a and IL-6 production in the human monocyte-macrophage THP-1 cell line as well as in human peripheral blood mononuclear cells PMID: 22752116
  16. clinically non-functioning adenomas had a significant decrease (P<0.001) in the relative levels of GADD45c expression (13 of 14 adenomas or 92%), compared to functioning adenomas (11 of 24 or 46%) PMID: 21850407
  17. Data show that mda-7/IL-24 activation leads to upregulation of growth arrest and DNA damage inducible (GADD) 45 alpha and gamma and JNK activation. PMID: 21931671
  18. These results reveal the mechanism of self-association by Gadd45 proteins and the importance of this self-association for their biological function PMID: 22058036
  19. The induction of GADD45gamma gene expression by 1,25-(OH)2D3 may mark therapeutic response in prostate cancer. PMID: 20739400
  20. Epigenetic regulation of GADD45G is associated with carcinogenesis in stomach, colorectal and pancreateic cancers. PMID: 20111973
  21. Flow cytometric analysis revealed significant G2/M arrest in cells transfected with either Gadd45alpha or Gadd45gamma. Importantly, we found that expression of either Gadd45alpha or Gadd45gamma activated P38 and JNK kinase pathways to induce G2/M arrest. PMID: 19048389
  22. a powerful growth suppressor controlling pituitary cell proliferation and the first identified gene whose expression is lost in the majority of human pituitary tumors. PMID: 11889197
  23. results suggest that CRIF1 is a novel nuclear protein that interacts with Gadd45 and may play a role in negative regulation of cell cycle progression and cell growth PMID: 12716909
  24. Data show that GADD45 gamma mRNA expression is down-regulated in hepatocellular carcinoma, and that GADD45 gamma causes cell cycle arrest at G2/M transition when transfected into Hep-G2 cells. PMID: 14672412
  25. GADD45g induction by androgens requires new protein synthesis; overexpression of GADD45g inhibited cell growth and caused morphological changes in prostate cell lines, arguing that GADD45g is involved in differentiation induced by androgens PMID: 15062559
  26. Inhibition of GADD45alpha and gamma in cancer cells by small interfering RNA abrogates apoptosis induction by the inhibitor of NF-kappaB PMID: 15353598
  27. Results show that GADD45G can act as a functional new-age tumor suppressor but being frequently inactivated epigenetically in multiple tumors. PMID: 16166418
  28. Establish MDA-7/IL-24 and GADD45alpha and GADD45gamma as critical mediators of apoptosis and growth arrest in response to NSAIDs in cancer cells. PMID: 17178890
  29. Human Gadd45gamma and its selenomethionine derivative were expressed in an Escherichia coli expression system and purified; they were then crystallized using the hanging-drop vapour-diffusion method. PMID: 18997345
  30. urinary GADD45gamma expression is associated with progression of renal disease PMID: 19293565

Show More

Hide All

Protein Families
GADD45 family
Database Links

HGNC: 4097

OMIM: 604949

KEGG: hsa:10912

STRING: 9606.ENSP00000252506

UniGene: Hs.9701

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*