Recombinant Human Growth/differentiation factor 11(GDF11)


In Stock
Code CSB-EP009344HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O95390
Relevance Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. Play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP009344HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) GDF11.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP009344HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) GDF11.
Storage Buffer Tris-based buffer,50% glycerol
Alias Bone morphogenetic protein 11 Short name: BMP-11
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Research Area Neuroscience
Source E.coli
Gene Names GDF11
Expression Region 299-407aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 28.5kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. May play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern (By similarity). Signals through activin receptors type-2, ACVR2A and ACVR2B, and activin receptors type-1, ACVR1B, ACVR1C and TGFBR1 leading to the phosphorylation of SMAD2 and SMAD3
Subcellular Location Secreted
Protein Families TGF-beta family
Database Links

HGNC: 4216

OMIM: 603936

KEGG: hsa:10220

STRING: 9606.ENSP00000257868

UniGene: Hs.600883

Related Products

GDF11 Antibodies

GDF11 Antibodies for Homo sapiens (Human)

GDF11 Proteins

GDF11 Proteins for Homo sapiens (Human)

GDF11 ELISA Kit

GDF11 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.