Code | CSB-EP009344HU |
Size | US$1726 |
Image |
|
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | GDF11 |
Uniprot No. | O95390 |
Research Area | Neuroscience |
Alternative Names | Bone morphogenetic protein 11 Short name: BMP-11 |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 299-407aa |
Target Protein Sequence | NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 28.5kDa |
Protein Length | Full Length of Mature Protein |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
Datasheet & COA | Please contact us to get it. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. May play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern (By similarity). Signals through activin receptors type-2, ACVR2A and ACVR2B, and activin receptors type-1, ACVR1B, ACVR1C and TGFBR1 leading to the phosphorylation of SMAD2 and SMAD3 |
Subcellular Location | Secreted |
Protein Families | TGF-beta family |
Database Links |
HGNC: 4216 OMIM: 603936 KEGG: hsa:10220 STRING: 9606.ENSP00000257868 UniGene: Hs.600883 |
Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase(LIPA)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Sulfite oxidase, mitochondrial(SUOX)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Alpha-tocopherol transfer protein(TTPA)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Nuclear cap-binding protein subunit 2(NCBP2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human 60S acidic ribosomal protein P0(RPLP0)
Express system: E.coli
Species: Homo sapiens (Human)
Tel: 301-363-4651
Email: support@cusabio.com
Distributors Worldwide