Recombinant Human Growth/differentiation factor 8(MSTN)

In Stock
Code CSB-EP015057HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O14793
Relevance Acts specifically as a negative regulator of skeletal muscle growth.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias Myostatin
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Research Area Signal Transduction
Source E.coli
Gene Names MSTN
Expression Region 267-375aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 16.4kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Acts specifically as a negative regulator of skeletal muscle growth.
Involvement in disease Muscle hypertrophy (MSLHP)
Subcellular Location Secreted
Protein Families TGF-beta family
Database Links

HGNC: 4223

OMIM: 601788

KEGG: hsa:2660

STRING: 9606.ENSP00000260950

UniGene: Hs.41565

Related Products

MSTN Antibodies

MSTN Antibodies for Homo sapiens (Human)

MSTN Antibodies for Human

MSTN Proteins

MSTN Proteins for Homo sapiens (Human)

MSTN ELISA Kit

MSTN ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.