Recombinant Human Hepatic sodium/bile acid cotransporter (SLC10A1)-VLPs

In Stock
Code CSB-MP623947HU(A4)
Abbreviation Recombinant Human SLC10A1 protein-VLPs
MSDS
Size $315
Order now
Image
  • CSB-MP623947HU(A4) is detected by Mouse anti-6*His monoclonal antibody.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
VLPs
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Cell growth-inhibiting gene 29 protein;Sodium/taurocholate cotransporting polypeptide;NTCP;Solute carrier family 10 member 1;SLC10A1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-349aa
Target Protein Sequence
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.5 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium.; (Microbial infection) Acts as a receptor for hepatitis B virus.
Gene References into Functions
  1. we review the current knowledge of the functional role and the molecular and cellular biology of NTCP in the life cycle of the three major hepatotropic viruses, highlight the impact of NTCP as an antiviral target and discuss future avenues of research PMID: 30097692
  2. In this study, the authors identified new hepatitis B virus isolates from one homozygous S267F NTCP mutation carrier and confirmed new isolates also use wildtype-NTCP as a cellular receptor. Furthermore, we demonstrated S267F variant of NTCP, though inefficient, is still a functional receptor for hepatitis B virus entry. PMID: 30032030
  3. These findings suggest that host factors unique to HepaRG cells are required for efficient infection by serum-derived HBV, and factors other than NTCP contribute to balanced viral antigen production following infection by cell culture-derived HBV. PMID: 29793953
  4. These kinetic results provide important complementary data on the substrate selectivity and specificity of NTCP to transport bile acids. PMID: 29024779
  5. Results show that NTCP inhibition suppressed the in vivo spread of HBV infection in the presence of uninfected hepatocytes. Livers in CHB patients contained varying degrees of HBsAg-negative hepatocytes, as evidenced by immunohistochemistry. PMID: 27278060
  6. These results uncover NTCP as a mediator of innate antiviral immune responses in the liver. PMID: 27783949
  7. For Tibetans and Uygurs, no association of the three NTCP SNPs (rs7154439, rs4646287 and rs2296651) and their haplotypes with hepatitis B virus chronicity was observed. PMID: 27051045
  8. the present study indicated that the common variants in the regulatory elements of NTCP may not influence the expression level of SLC10A1 at transcriptional regulation, and ultimately may not be associated with HBV susceptibility. PMID: 27491457
  9. The data showed that S267F of sodium taurocholate cotransporting polypeptide is not associated with hepatitis B virus infection, and is not prevalent in the general Moroccan population. PMID: 28125961
  10. The SLC10A1 (NTCP) S267F variant is independently associated with decreased risk of progression to Liver cirrhosis and Hepatocellular Carcinoma , and resistance to Chronic Hepatitis B infection. PMID: 26642861
  11. In conclusion, NTCP appeared inefficient to mediate infection by serum-derived hepatitis B virus. PMID: 27384660
  12. Computer screening of NTCP inhibitors and non-inhibitors showed no relationship between the drugs and drug induced liver injury. PMID: 25220493
  13. We found a genetic variant (rs4646287) located in intron 1 of NTCP that may be associated with increased risk of HBV infection in Han Chinese PMID: 26968990
  14. The observation that the pharmacological inhibitors of the NTCP transporter could block HBV entry suggests that NTCP represents an attractive molecular target for therapeutic intervention in HBV infection. PMID: 25929767
  15. Hepatitis B virus efficiently infects non-adherent hepatoma cells via NTCP, which functions as a virus receptor. PMID: 26592202
  16. We describe for the first time a mouse liver cell line that, solely upon expression of the hNTCP receptor, becomes susceptible to HBV. PMID: 26865711
  17. This study suggests that polymorphisms in the NTCP region may be associated with the natural course of HBV infection. PMID: 25010264
  18. Liver nuclear receptors, FXR and SHP, and bile acid transporters, NTCP and BSEP, are associated with the progression of NAFLD. PMID: 26019035
  19. Interleukin 6 inhibits HBV entry through downregulation of NTCP. PMID: 25765005
  20. NTCP is a functional receptor for hepatitis B virus and hepatitis D virus. PMID: 25409679
  21. NTCP polymorphism play a critical role in the individual variability of rosuvastatin pharmacokinetics in Chinese healthy males PMID: 25985569
  22. NTCP is a functional receptor for human hepatitis B and D virus. PMID: 23150796
  23. hNTCP is an electrogenic Na(+)-dependent transporter PMID: 25168282
  24. findings suggest that the rs2296651 polymorphism in NTCP may predispose the susceptibility to and chronicity of HBV infection PMID: 24735529
  25. Viral entry of hepatitis B and D viruses and bile salts transportation share common molecular determinants on NTCP. PMID: 24390325
  26. Human NTCP is a specific receptor for hepatitis B and D viruses, allowing virus entry into hepatocytes. PMID: 24361467
  27. Polymorphisms in CYP2C9, CYP2C19 and SLC10A1 had minimal lipid-lowering effects. PMID: 23930675
  28. Knockdown analysis suggested that HBV infection of HepG2-hNTCP-C4 cells was mediated by NTCP. PMID: 24342612
  29. This study was conducted to determine which of the 8 cysteine residues of NTCP is responsible for nitric oxide-mediated S-nitrosylation and inhibition of taurocholate uptake. PMID: 23886862
  30. Data suggest that, in SLC10A1, amino acid residues along one face of transmembrane domain 5 do not play direct role in substrate transport but are critical for sodium/bile acid transport functions of SLC10A1, most likely through helical stability. PMID: 23815591
  31. these results suggest that the plasma membrane localization rather than kinase activity of PKCdelta plays an important role in cAMP-induced NTCP translocation and Rab4 activity PMID: 22744337
  32. Patients undergoing partial hepatectomy with low post-operative bilirubin had lower levels of NTCP, MDR3 and BSEP mRNA compared to those with high bilirubin after Pringle manoeuvre. PMID: 22098322
  33. NTCP adopts a dimeric structure in which individual subunits are functional. Bile salt uptake is influenced by heterodimerization when this impairs NTCP plasma membrane trafficking. PMID: 22029531
  34. essential role of Na+-taurocholate co-transporting polypeptide (NTCP) in the uptake of bile acids, by which the enterohepatic recirculation of bile acids is maintained PMID: 21341987
  35. Inhibition of taurocholate uptake by nitric oxide involves S-nitrosylation of NTCP. PMID: 21109590
  36. The mRNA expression levels of sodium taurocholate cotransporting polypeptide, bile salt export pump, and hepatic cholesterol 7alpha-hydroxylase were significantly higher in the primary biliary cirrhosis patients than in the controls. PMID: 20857261
  37. Translation/insertion scanning, alanine insertion, and glycosylation site mutagenesis studies of liver sodium/bile acid cotransporter support a topography with nine membrane-spanning or membrane-associated segments. PMID: 12044156
  38. a domain critical for bile acid substrate recognition of SLC10A1 has an ethnicity-dependent polymorphism PMID: 14660639
  39. Conserved NTCP/Ntcp 5'-regulatory region transcription regulation differs among species and is not directly regulated by small heterodimer partner. Bile acids may regulate NTCP/Ntcp indirectly by modulating nuclear factor regulation of gene expression. PMID: 14701722
  40. The present studies were undertaken to establish a suitable in vitro experimental model to study human ASBT function and its regulation by cholesterol. PMID: 15604201
  41. The major canalicular transporter genes are expressed at mid-gestational stage during human fetal development. PMID: 15922475
  42. Results suggest that the Ser-226 in the third cytoplasmic loop of NTCP is phosphorylated and cAMP may increase NTCP translocation to the cell membrane by dephosphorylating NTCP at this site. PMID: 16027164
  43. The GR/dexamethasone activation of the hNTCP promoter is counteracted by bile acids and small heterodimer partner, providing a negative feedback mechanism for bile acid uptake in human hepatocytes. PMID: 16123152
  44. Cholesterol treatment led to increased levels of NTCP and OCT-1 mRNAs. PMID: 17635184

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Bile acid:sodium symporter (BASS) (TC 2.A.28) family
Database Links

HGNC: 10905

OMIM: 182396

KEGG: hsa:6554

STRING: 9606.ENSP00000216540

UniGene: Hs.952

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*