Code | CSB-EP008532HU |
Size | $1812 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The production of this Recombinant Human FCER1A protein required the insertion of a DNA fragment (FCER1A, 26-205aa) into a plasmid vector and the transferral of this vector into E.coli cells (the step of transformation). The cells were then cultured and induced to express the FCER1A protein. This recombinant protein was fused with N-terminal 6xHis-SUMO tag. Its purity is 90%+ determined by SDS-PAGE. FCER1A (also known as FCE1A) is a gene providing an instruction of making a protein named high affinity immunoglobulin epsilon receptor subunit alpha (FCER1A) in human. FCER1A protein is also known as Fc-epsilon RI-alpha (FcERI) and IgE Fc receptor subunit alpha. This protein is a component of immunoglobulin epsilon receptor (IgE receptor), which is comprised of an alpha subunit, a beta subunit, and two gamma subunits. IgE receptor is the initiator of the allergic response by binding to the Fc region of immunoglobulins epsilon. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | FCER1A |
Uniprot No. | P12319 |
Research Area | Immunology |
Alternative Names |
Fc epsilon RI alpha; Fc epsilon RI alpha chain ; Fc epsilon RI alpha-chain; Fc fragment of IgE high affinity I receptor for alpha polypeptide; Fc fragment of IgE; high affinity I; receptor for; alpha subunit; Fc fragment of IgE; high affinity I; receptor for; alpha polypeptide; Fc IgE receptor alpha polypeptide; Fc IgE receptor; alpha chain; Fc IgE receptor; alpha polypeptide; Fc of IgE high affinity I receptor for alpha polypeptide; Fc-epsilon RI-alpha; FCE 1A; FCE1A; FCER 1A; Fcer1a; FCERA_HUMAN; FceRI alpha; FcERI; high affinity IgE receptor; High affinity immunoglobulin epsilon receptor alpha subunit; high affinity immunoglobulin epsilon receptor alpha-subunit; High affinity immunoglobulin epsilon receptor subunit alpha; IgE Fc receptor alpha subunit; IgE Fc receptor subunit alpha; Immunoglobulin E receptor high affinity of mast cells alpha polypeptide ; immunoglobulin E receptor; high-affinity; of mast cells; alpha polypeptide
|
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 26-205aa |
Target Protein Sequence | VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 37.0kDa |
Protein Length | Extracellular Domain |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Database Links |
HGNC: 3609 OMIM: 147140 KEGG: hsa:2205 STRING: 9606.ENSP00000357097 UniGene: Hs.897 |