Recombinant Human High affinity immunoglobulin epsilon receptor subunit alpha(FCER1A),partial

Code CSB-YP008532HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P12319
Relevance Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Fc-epsilon RI-alpha Short name: FcERI IgE Fc receptor subunit alpha
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ
Research Area Immunology
Source Yeast
Gene Names FCER1A
Protein Names Recommended name: High affinity immunoglobulin epsilon receptor subunit alpha Alternative name(s): Fc-epsilon RI-alpha Short name= FcERI IgE Fc receptor subunit alpha
Expression Region 26-205aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 23.0kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Database Links

HGNC: 3609

OMIM: 147140

KEGG: hsa:2205

STRING: 9606.ENSP00000357097

UniGene: Hs.897

Pathway Fc epsilon RI signaling pathway
Oxidative Phosphorylation
Phospholipase D signaling pathway
Sphingolipid signaling pathway

Related Products

FCER1A Antibodies

FCER1A Antibodies for Homo sapiens (Human)

FCER1A Antibodies for Human

FCER1A Proteins

FCER1A Proteins for Homo sapiens (Human)

FCER1A ELISA Kit

FCER1A ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.