Recombinant Human Histone H2B type 1-B(HIST1H2BB)

Code CSB-EP010402HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P33778
Relevance Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a tplate. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome rodeling.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Histone H2B.1Histone H2B.f ;H2B/f
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names HIST1H2BB
Expression Region 2-126aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 29.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Subcellular Location Nucleus, Chromosome
Protein Families Histone H2B family
Database Links

HGNC: 4751

OMIM: 602803

KEGG: hsa:3018

STRING: 9606.ENSP00000350580

UniGene: Hs.553494

Related Products

HIST1H2BB Antibodies

HIST1H2BB Antibodies for Human

HIST1H2BB Antibodies for Homo sapiens (Human)

HIST1H2BB Proteins

HIST1H2BB Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.